FZD2 Protein, Human (HEK293, Fc)

FZD2 protein is a receptor for Wnt proteins that activates the β-catenin classical pathway, inhibits GSK-3 kinase and triggers Wnt target genes. FZD2 and some family members possess a secondary PKC-calcium pathway, but its integration with the classical pathway remains unclear. FZD2 Protein, Human (HEK293, Fc) is the recombinant human-derived FZD2 protein, expressed by HEK293 , with C-hFc labeled tag.

FZD2 Protein functions as a receptor for Wnt proteins, typically engaging the beta-catenin canonical signaling pathway, leading to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. Some family members, including FZD2, have demonstrated a secondary signaling pathway involving PKC and calcium fluxes, the integration of which with the canonical pathway remains to be fully elucidated, as PKC appears essential for Wnt-mediated inactivation of GSK-3 kinase. These pathways likely involve interactions with G-proteins and may play roles in transduction and intercellular transmission of polarity information during tissue morphogenesis and in differentiated tissues. Notably, FZD2 acts as a receptor for C.difficile toxin TcdB in the colonic epithelium, where TcdB binding occupies the Wnt-adducted palmitoleate binding site in frizzled receptors, preventing Wnt binding and downstream Wnt signaling.

Immobilized FZD2 at 2 μg/mL (100 μL/well) can bind biotinylated Wnt5a (HY-P702853). The ED₅₀ for this effect is 54.93 nM.

• 
  Immobilized FZD2 at 2 μg/mL (100 μL/well) can bind biotinylated Wnt5a (HY-P702853). The ED₅₀ for this effect is 54.93 nM.

Human

HEK293

C-hFc

Q14332 (Q24-P190)

2535  [NCBI]

Partial

QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPP

50-62 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.