1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. G-CSF Protein, Human

Granulocyte colony-stimulating factor (G-CSF) is a glycoprotein secreted by the cells of the immune system, fibroblasts and endothelium, which acts as a hematopoietic and endothelial precursor cells cytokine. G-CSF stimulates maturation of progenitor cells in the bone marrow into differentiated granulocytes, macrophages and the T cells. G-CSF also shows to convey neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway and regulates epithelial to mesenchymal transition in cancer. G-CSF Protein (Human) is a recombinant protein with tag free that consists of 200 or 204 amino acids, which is expressed in E. coli.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
2 μg En stock
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
250 μg En stock
500 μg En stock
> 500 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE G-CSF Protein, Human

Bio/Physico-chemical Assay

    G-CSF Protein, Human purchased from MCE. Usage Cited in: Int Immunopharmacol. 2024 Oct 29;143(Pt 2):113504.  [Abstract]

    G-CSF Protein, Human (20 ng/mL). Concentrations of the highest O2 production rates (n = 6).
    • Activité biologique

    • Paramètres Techniques

    • Propriétés

    • Description

    • Références

    Description

    Granulocyte colony-stimulating factor (G-CSF) is a glycoprotein secreted by the cells of the immune system, fibroblasts and endothelium, which acts as a hematopoietic and endothelial precursor cells cytokine. G-CSF stimulates maturation of progenitor cells in the bone marrow into differentiated granulocytes, macrophages and the T cells. G-CSF also shows to convey neuroprotection to central neurons upon increases in phosphorylation of PI3K/Akt pathway and regulates epithelial to mesenchymal transition in cancer. G-CSF Protein (Human) is a recombinant protein with tag free that consists of 200 or 204 amino acids, which is expressed in E. coli[1][2][3][4][5][6][7][8].

    Background

    G-CSF Protein (Human) is a glycoprotein, acting to stimulate granulopoiesis, the innate immunity, and the differentiation of neural progenitor cells[1].
    G-CSF Protein (Human) levels are associated with various cancers, such as lung cancer, glioma, colorectal cancers, bladder cancer, melanoma, skin carcinom, bone metastases in cancers of prostate and breast, , and more[1].
    G-CSF Protein (Human) acts via a specific cognate receptor (G-CSFR) that belongs to the class I cytokine receptor superfamily, and then activates members of the Janus kinase family (JAK1, JAK2, and TYK2), cytoplasmic tyrosine kinases associated with Box 1. G-CSF Protein (Human) stimulates the proliferation, differentiation, and function of myeloid progenitors and mobilization of hematopoietic stem and progenitor cells, which shows potential application for skeletal muscle repair and regeneration[2].
    G-CSF Protein (Human) induces hematopoietic stem/progenitor cell mobilisation and stimulates angiogenesisrelated endothelial cell proliferation and migration and has the potential to inhibit the progression of atherosclerosis in animal models[3].
    G-CSF Protein (Human) expression is enhanced by activation of the RAS/MEK/ERK pathway through the Ets transcription factor and promotes resistance to anti-VEGF therapy[5].
    G-CSF Protein (Human) promotes the viability and angiogenesis of injured liver via direct efects on the liver cells[8].

    In Vitro

    Incubation of alpha-smooth muscle actin (αSMA+)/CD105+/CD31- cells with FGFs induces G-CSF Protein (Human) release in a MEK-dependent manner[5].
    G-CSF Protein (Human) (0.5, 1, 10 μg/mL, 0-96 h) directly promotes cell viability and VEGF-A expression in human injured liver cells[8].

    In Vivo

    G-CSF Protein (Human) improves recovery after muscle crush injury, significantly increasing muscle strength in male Wistar rats. G-CSF Protein (Human) also increases rates of regeneration and activation of anabolic signalling pathways, such as Akt in mice injected with snake venom to cause skeletal muscle necrosis[2].
    G-CSF Protein (Human) (≤100 μg/kg, i.v. or s.c. or i.p., daily for 6,8,12 weeks) reduces the area of atherosclerotic lesions in rabbit and mouse models of atherosclerosis[3].
    G-CSF Protein (Human) (5 μg/kg , infusion, a sinfle dose at 4 h and 24 h) induces a 3-4 fold spike in circulating endothelial progenitor cells (CEPs) levels, similar to that using OXi-4503 (HY-16147) in non tumor bearing BALB/c and C57Bl/6 mice[4].
    G-CSF Protein (Human) plasma levels are substantially elevated after treated with OXi-4503 (HY-16147) (100 mg/kg, i.p., a single dose for 4 h) in G-CSF-R−/− mice bearing subcutaneous Lewis Lung Carcinoma (LLC) transplants[4].
    G-CSF Protein (Human)--mediated resistance to antivascular endothelial growth factor (VEGF) therapies occurs through activation of RAS/MEK/ERK pathways and an Ets-induced overexpression of G-CSF Protein (Human) in murine models of pancreatic adenocarcinoma expressing RAS oncogene[5].
    G-CSF Protein (Human) (250 µg/kg, s.c., a single dose) relieves liver injury and shows positive correlation with viability and angiogenesis in the injured liver in the injured liver mouse model[8].

    Activité biologique

    The ED50 is <0.1 ng/mL as measured by M-NFS-60 cells, corresponding to a specific activity of >1.0 × 107 units/mg.

    • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 10.17 pg/mL, corresponding to a specific activity is 9.83×107 units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    Q8N4W3 (T27-P200)/P09919-2 (T31-P204)

    Gene ID
    Molecular Construction
    N-term
    G-CSF (T31-P204)
    Accession # P09919-2
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Granulocyte Colony-Stimulating Factor; G-CSF; Pluripoietin; Filgrastim; Lenograstim; CSF3; C17orf33; GCSF
    AA Sequence

    TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

    Predicted Molecular Mass
    18.8 kDa
    Masse moléculaire

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

    Pureté
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, 0.004% Tween 80, 5% Mannitol, pH 4.0.
    2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
    3.Lyophilized from a 0.22 μm filtered solution of 25 mM Tris, pH 8.0.
    4.Lyophilized from a 0.22 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, pH 4.0.
    5.Lyophilized from a 0.22 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, pH 4.0, 10% trehalose, 0.02% Tween80.
    6.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Livraison

    Room temperature in continental US; may vary elsewhere.

    Documentation
    Références

    G-CSF Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Vos produits récemment consultés:

    Demande en ligne

    Your information is safe with us. * Required Fields.

    G-CSF Protein, Human

     

    Requested Quantity *

    Nom du demandeur *

     

    Civilité

    Adresse e-mail *

     

    Numéro de téléphone *

    Department

     

    Nom de l'organisation *

    City

    État

    Country or Region *

         

    Remarques

    Bulk Inquiry

    Inquiry Information

    Nom du produit:
    G-CSF Protein, Human
    Cat. No.:
    HY-P70422
    Quantité:
    MCE Japan Authorized Agent: