IFN-alpha 1b/IFNA13 Protein, Human
Based on 1 publication(s) in Google Scholar
IFN-alpha 1/13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway, exerts function by inhibiting viral replication as well as modulating immune response. IFN-alpha 1b/IFNA13 Protein, Human contains 166 a.a. (C24-D189, A137V), produced in E. coli cells with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-alpha 1/13 (IFNA1), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 1 involves in the activation of JAK1 and TYK2 pathway[4], exerts function by inhibiting viral replication as well as modulating immune response[3]. IFN-alpha 1b/IFNA13 Protein, Human contains 166 a.a. (C24-D189, A137V), produced in E. coli cells with tag free.
Background
Interferon alpha-1/13 is produced by the macrophages, belongs to the alpha/beta interferon (IFN) family, a family of cytokines induced by viral infection and are primarily involved in antiviral defense of the cells[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha13 exhibits acid-stable antiviral activity against Theiler's virus, Mengo virus, and vesicular stomatitis virus. Firstly, it is transcribed constitutively, independent of viral infection and of interferon regulatory factor-7 induction. Secondly, it contains two N-glycosylation sites, in contrast to other murine IFN-alpha subtypes that contain either one or no N-glycosylation site[4]. As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA13 protein of human is very different from mouse (64.55%)
Verified Bioactivity
The specific activity determined by an anti-viral assay is no less than 1.0 × 108 IU/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P01562 (C24-E189, A137V)
-
Molecular Construction
-
N-term
-
IFNA1 (C24-E189, A137V)
Accession # P01562 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA1; Interferon Alpha-1; Interferon Alpha 1; Interferon Alpha-D; IFN-AlphaD; Interferon-Alpha1; IFN-ALPHA; IFN-Alpha-1; IFNA13; LeIF D; IFNA@; Interferon Alpha-1/13; IFL; IFN-Alpha-1/13; IFN; IFN-Alpha 1b; Interferon Alpha 1b
-
AA Sequence
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
-
Predicted Molecular Mass
19.5 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, containing 4% mannitol and 1% HSA.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27(2):240-52. [Content Brief]
[2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]
[3]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5. [Content Brief]
[4]. van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278(47):46321-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
