IL-11R alpha Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas. IL-11R alpha Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 344 amino acids (S24-Q367) and is produced by HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction[1]. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4]. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas[5]. IL-11R alpha Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 344 amino acids (S24-Q367) and is produced by HEK293 cells.

Background

IL-11RA is highly expressed on stromal cells, including fibroblasts, smooth muscle cells, adipocytes, and hepatic/pancreatic stellate cells or pericytes, and also on epithelial/polarized cells, such as hepatocytes, alveolar epithelial cells, and kidney tubular epithelial cells[1].
The amino acid sequence of human IL-11R alpha protein has low homology between mouse and rat IL-11R alpha protein.
IL-11R alpha is the receptor of IL-11, and signaling mechanism triggered by IL-11 is mediated through IL-11R alpha. IL-11R alpha can bind IL-11 and then the comples attracts gp130 leading to signal transduction. Besides, IL11RA has been demonstrated to activate IL-11-mediated gp130 signaling but not the naturally occurring form of the soluble IL-11 receptor. Binding of IL-11 to IL11RA triggers heterodimerization, tyrosine phosphorylation, and activation of gp130. The activated IL11RA–gp130 receptor complex further activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3].
IL-11R alpha also acts as IL-11 agonist in vitro[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4][5].

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-11Rα (S24-Q367)
      Accession # Q64385
    • 6*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    IL11RA; IL-11R Subunit Alpha; Interleukin 11 Receptor Subunit Alpha; Interleukin-11 Receptor Alpha Chain; Interleukin-11 Receptor Subunit Alpha; IL-11R-Alpha; Interleukin 11 Receptor, Alpha; IL-11RA; IL-11 Receptor Subunit Alpha; CRSDA

  • AA Sequence

    SPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLQDEIPDWSQGHGQQLEAVVAQEDSPAPARPSLQPDPRPLDHRDPLEQ

  • Predicted Molecular Mass

    38.5 kDa

  • Molecular Weight

    Approximately 40-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00