1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11 Receptor
  5. IL-11R alpha
  6. IL-11R alpha Protein, Mouse (HEK293, His)

IL-11R alpha Protein, Mouse (HEK293, His)

Cat. No.: HY-P70860
Handling Instructions

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas. IL-11R alpha Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 344 amino acids (S24-Q367) and is produced by HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-11R alpha (IL-11RA) is the IL-11 receptor subunit α and also acts as an agonist of IL-11. IL-11R alpha binds to IL6ST/gp130 on cell surfaces and induces signal transduction[1]. IL-11R alpha activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4]. IL-11R alpha plays an important role in the progression and the differentiation of human gastric carcinomas[5]. IL-11R alpha Protein, Mouse (HEK293, His) is a recombinant protein with a His label that consists of 344 amino acids (S24-Q367) and is produced by HEK293 cells.

Background

IL-11RA is highly expressed on stromal cells, including fibroblasts, smooth muscle cells, adipocytes, and hepatic/pancreatic stellate cells or pericytes, and also on epithelial/polarized cells, such as hepatocytes, alveolar epithelial cells, and kidney tubular epithelial cells[1].
The amino acid sequence of human IL-11R alpha protein has low homology between mouse and rat IL-11R alpha protein.
IL-11R alpha is the receptor of IL-11, and signaling mechanism triggered by IL-11 is mediated through IL-11R alpha. IL-11R alpha can bind IL-11 and then the comples attracts gp130 leading to signal transduction. Besides, IL11RA has been demonstrated to activate IL-11-mediated gp130 signaling but not the naturally occurring form of the soluble IL-11 receptor. Binding of IL-11 to IL11RA triggers heterodimerization, tyrosine phosphorylation, and activation of gp130. The activated IL11RA–gp130 receptor complex further activates Jak family of tyrosine kinases, JAK1, JAK2, and TYK2[3].
IL-11R alpha also acts as IL-11 agonist in vitro[3]. IL-11R alpha induces proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells[4][5].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q64385 (S24-Q367)

Gene ID

16157  [NCBI]

Molecular Construction
N-term
IL-11Rα (S24-Q367)
Accession # Q64385
6*His
C-term
Synonyms
IL-11 R alpha; IL11R alpha; IL11RA; IL-11Ra; Il11ra2; NR1
AA Sequence

SPCPQAWGPPGVQYGQPGRPVMLCCPGVSAGTPVSWFRDGDSRLLQGPDSGLGHRLVLAQVDSPDEGTYVCQTLDGVSGGMVTLKLGFPPARPEVSCQAVDYENFSCTWSPGQVSGLPTRYLTSYRKKTLPGAESQRESPSTGPWPCPQDPLEASRCVVHGAEFWSEYRINVTEVNPLGASTCLLDVRLQSILRPDPPQGLRVESVPGYPRRLHASWTYPASWRRQPHFLLKFRLQYRPAQHPAWSTVEPIGLEEVITDAVAGLPHAVRVSARDFLDAGTWSAWSPEAWGTPSTGPLQDEIPDWSQGHGQQLEAVVAQEDSPAPARPSLQPDPRPLDHRDPLEQ

Molecular Weight

40-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

IL-11R alpha Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11R alpha Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70860
Quantity:
MCE Japan Authorized Agent: