IL-17RC Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

IL-17RC (Interleukin 17 receptor C), a receptor for IL-17A and IL-17F, is a type I membrane glycoprotein. It is expressed on a variety of nonhematopoietic cell types, and plays a role in inflammatory diseases, including autoimmunity and certain cancers. IL-17RC associates with IL-17RA to form a signaling receptor complex for IL-17A and IL-17F. IL-17RC Protein, Human (sf9, His) is produced in Sf9 insect cells with a C-Terminal His-tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-17RC (Interleukin 17 receptor C), a receptor for IL-17A and IL-17F, is a type I membrane glycoprotein. It is expressed on a variety of nonhematopoietic cell types, and plays a role in inflammatory diseases, including autoimmunity and certain cancers. IL-17RC associates with IL-17RA to form a signaling receptor complex for IL-17A and IL-17F[1][2]. IL-17RC Protein, Human (sf9, His) is produced in Sf9 insect cells with a C-Terminal His-tag.

Background

IL-17RC, is the receptor for IL17A and IL17F homodimers as part of a heterodimeric complex with IL17RA. IL-17 cytokine family members IL-17A and IL-17F mediate inflammatory activities via the IL-17R complex, comprised of the IL-17RA and IL-17RC subunits. The expression profile and tissue distribution of IL-17RC suggest that the gene regulation of IL-17RC differs considerably from IL-17RA. Specifically, epithelial cells of the prostate, kidney, and joints express high levels of IL-17RC mRNA, while low levels of expression are detected in the hematopoietic cell compartments[1].
The amino acid sequence of human IL-17RC protein has low homology with mouse IL-17C protein. The differences between the human and murine systems extend to IL-17A and IL-17F cytokine binding affinities. hIL-17RA binds preferentially to IL-17A and has a relatively low binding affinity to IL-17F. In contrast, hIL-17RC binds IL-17A and IL-17F with the same affinity. In the murine system, the inverse is true: mIL-17RA binds IL-17A and IL-17F with equal affinities, but mIL-17RC binds preferentially to IL-17F. Therefore, in both humans and mice, IL-17RC appears to serve as a contact point for IL-17F[1].
The IL-17R subfamily includes IL-17RA, IL-17RB, IL-17RC, IL-17RD, and IL-17RE. The best-characterized IL-17R molecules are the IL-17RA and IL-17RC subunits, in part because of their interaction to form a receptor complex capable specific for IL-17A and IL-17F. IL-17RA co-immunoprecipitates with IL-17RC in a ligand-dependent manner, raising the possibility that the ligand-dependent loss of FRET between IL-17RA subunits results from oligomerization with IL-17RC. Consistent with this, IL-17RC also forms large, multimeric complexes consistent with oligomerization with IL-17RA. IL-17RC forms heterodimers with IL-17RA to mediate IL-17A and IL-17F signals in mouse stromal cells and human gastric adenocarcinoma AGS cells and synoviocytes. Although The IL-17RA and IL-17RC subunits operate in concert to mediate IL-17 signaling, IL-17RC possesses a number of features that differentiate it from IL-17RA. IL-17RC bears only 22% sequence homology with IL-17RA. Alignment against the human genome indicates that the il17rc gene contains 19 exons on chromosome 3 and spans 16,550 base pairs within the chromosomal region 3p25.3 to 3.24.1. The murine il17rc gene contains 18 exons on chromsome 6 and spans 11,565 base pairs on the chromosomal arm 6q. The full-length human IL-17RC (hIL-17RC) contains 720 amino acids, and the murine IL-17RC (mIL-17RC) contains 698 amino acids. In both species, il17rc encodes a single pass type I transmembrane protein where the transmembrane domain is encoded in exon 17[1][2].
The initial discovery of IL-17RC was based on its high levels of expression in human prostate cancer cells. Specific overexpression of IL-17RC protects prostate cancer cell lines from TNFα-induced apoptosis. IL-17RC also contributes to autoimmune disease pathogenesis. In rheumatoid arthritis (RA) models have high levels of IL-17A, IL-17F, IL-17RA, and IL-17RC in sera and inflamed synovium. Furthermore, based on RNAi blocking experiments, both IL-17RA and IL-17RC are required for the pro-inflammatory factors secreted by RA synoviocytes. The gene transcript analyses of psoriatic lesions revealed an impairment of IL-17RC mRNA expression. Perhaps this defect in IL-17RC expression leads to a compensatory effect, which could result in overactive Th17 cells and an inflammatory program[1][2].

Verified Bioactivity

1. Measured by its ability to bind with recombinant human IL17A-His (Cat:12047-H07B) in a functional ELISA.
2. Measured by its ability to bind with recombinant human 17A (Cat:12047-HNAE) in a functional ELISA.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-17RC (L21-A454)
      Accession # Q8NAC3-3
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL17RC; IL17Rhom; Interleukin 17 Receptor C; IL-17RL; Interleukin-17 Receptor-Like Protein; CDNA PSEC0233 Fis, Clone HEMBA1006813; Interleukin-17 Receptor C; IL17F Receptor; ZcytoR14; IL-17RC; IL17-RL; CANDF9; Interleukin-17 Receptor Homolog; IL17RL; IL-1

  • AA Sequence

    MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPGLSCRLWDSDILCLPGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVSADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLRLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA

  • Predicted Molecular Mass

    49.6 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 300 mM NaCl, pH 7.5, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00