IL-1RA/IL-1RN Protein, Cynomolgus (His)
Based on 1 Customer Validation
IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.
Background
The IL-1RA/IL-1RN mutant protein functions as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Engineered to enhance its inhibitory capabilities, this mutant variant plays a critical role in safeguarding the host from immune dysregulation and preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. By offering an optimized defense against IL1-mediated inflammatory responses, the mutant protein contributes significantly to maintaining immune balance and preventing excessive inflammation.
Verified Bioactivity
Immobilized Cynomolgus IL1RA at 10 µg/mL (100 µL/well) can bind Cynomolgus IL-1R2. The ED50 for this effect is 0.09916 μg/mL.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag C-6*His
-
Accession
NP_001270468.1 (R26-E177)
-
Gene ID102126145
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1RN; IL-1ra; Interleukin 1 Receptor Antagonist; Intracellular Interleukin-1 Receptor Antagonist (IcIL-1ra); ICIL-1RA; Intracellular Interleukin-1 Receptor Antagonist; IL-1RN; Intracellular IL-1 Receptor Antagonist Type II; IL1RA; Type II Interleukin-1 R
-
AA Sequence
RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE
-
Predicted Molecular Mass
18.6 kDa
-
Molecular Weight
Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)