1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-1RA
  5. IL-1RA/IL-1RN mutant Protein, Cynomolgus (His)

IL-1RA/IL-1RN mutant Protein, Cynomolgus (His)

Cat. No.: HY-P75853
Handling Instructions

The IL-1RA/IL-1RN mutant protein, an enhanced anti-inflammatory antagonist in the interleukin-1 family, specifically targets proinflammatory cytokines IL1B and IL1A. Engineered for increased inhibitory capabilities, this mutant variant critically safeguards the host from immune dysregulation and prevents uncontrolled systemic inflammation triggered by IL1 in response to innate stimulatory agents. Offering optimized defense against IL1-mediated inflammation, the mutant protein significantly contributes to maintaining immune balance and preventing excessive inflammation. IL-1RA/IL-1RN mutant Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli, with C-10*His labeled tag. The total length of IL-1RA/IL-1RN mutant Protein, Cynomolgus (His) is 152 a.a., with molecular weight of ~18.63 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-1RA/IL-1RN mutant protein, an enhanced anti-inflammatory antagonist in the interleukin-1 family, specifically targets proinflammatory cytokines IL1B and IL1A. Engineered for increased inhibitory capabilities, this mutant variant critically safeguards the host from immune dysregulation and prevents uncontrolled systemic inflammation triggered by IL1 in response to innate stimulatory agents. Offering optimized defense against IL1-mediated inflammation, the mutant protein significantly contributes to maintaining immune balance and preventing excessive inflammation. IL-1RA/IL-1RN mutant Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli, with C-10*His labeled tag. The total length of IL-1RA/IL-1RN mutant Protein, Cynomolgus (His) is 152 a.a., with molecular weight of ~18.63 kDa.

Background

The IL-1RA/IL-1RN mutant protein functions as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Engineered to enhance its inhibitory capabilities, this mutant variant plays a critical role in safeguarding the host from immune dysregulation and preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. By offering an optimized defense against IL1-mediated inflammatory responses, the mutant protein contributes significantly to maintaining immune balance and preventing excessive inflammation.

Species

Cynomolgus

Source

E. coli

Tag

C-10*His

Accession

P25086 (H27-Q178)

Gene ID

60582  [NCBI]

Molecular Construction
N-term
IL-1RA (H27-Q178)
Accession # P25086
10*His
C-term
Synonyms
Interleukin-1 receptor antagonist protein; IL-1RN; IL-1ra; Il1rn
AA Sequence

MRPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

Molecular Weight

Approximately 18.63 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-1RA/IL-1RN mutant Protein, Cynomolgus (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1RA/IL-1RN mutant Protein, Cynomolgus (His)
Cat. No.:
HY-P75853
Quantity:
MCE Japan Authorized Agent: