IL-1RA/IL-1RN Protein, Cynomolgus (His)

Customer Review

Based on 1 Customer Validation

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Cynomolgus (His) is the recombinant cynomolgus-derived IL-1RA/IL-1RN mutant protein, expressed by E. coli , with C-10*His labeled tag.

Background

The IL-1RA/IL-1RN mutant protein functions as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Engineered to enhance its inhibitory capabilities, this mutant variant plays a critical role in safeguarding the host from immune dysregulation and preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. By offering an optimized defense against IL1-mediated inflammatory responses, the mutant protein contributes significantly to maintaining immune balance and preventing excessive inflammation.

Verified Bioactivity

Immobilized Cynomolgus IL1RA at 10 µg/mL (100 µL/well) can bind Cynomolgus IL-1R2. The ED50 for this effect is 0.09916 μg/mL.

Technical Parameters

  • Species Cynomolgus
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1RN; IL-1ra; Interleukin 1 Receptor Antagonist; Intracellular Interleukin-1 Receptor Antagonist (IcIL-1ra); ICIL-1RA; Intracellular Interleukin-1 Receptor Antagonist; IL-1RN; Intracellular IL-1 Receptor Antagonist Type II; IL1RA; Type II Interleukin-1 R

  • AA Sequence

    RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDE

  • Predicted Molecular Mass

    18.6 kDa

  • Molecular Weight

    Approximately 18-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00