2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Interleukin & Receptors
  5. IL-23
  6. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (Sf9)

IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (Sf9)

Cat. No.: HY-P70421
COA Handling Instructions

For research use only. We do not sell to patients.

Size Price Stock Quantity
10 μg $150 In-stock
Estimated Time of Arrival: December 31
50 μg $450 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Biological Activity
1.Loaded Human IL-23R-Fc on Protein A Biosensor, can bind Mouse IL-23A with an affinity constant of 3.81 nM as determined in BLI assay.
2.Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED50 for this effect is 125.44 ng/mL.
Species

Mouse
Source

Sf9 insect cells
Tag

Tag Free
Accession

Q9EQ14 (V22-A196)&P43432 (M23-S335 )
Gene ID
Synonyms
SGRF; IL-23p19; CLMF p40; IL-12 subunit p40; NKSF2
AA Sequence

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
&:
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Weight

40&20 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.
Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping

Room temperature in continental US;may vary elsewhere.
Documentation

COA (229 KB)

Handling Instructions (2659 KB)

IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (Sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (Sf9)
Cat. No.:
HY-P70421
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email address *

     

Phone number *

 

Organization name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.