IL-12R beta 1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-12R beta 1 protein is an IL-12 cytokine surface receptor that activates the Jak-Stat signaling cascade pathway and is involved in IL-12-mediated immune regulation. IL-12R beta 1 Protein, Human (HEK293, His) is expressed by HEK293 cells with a C-terminal 6*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-12R beta 1 protein is an IL-12 cytokine surface receptor that activates the Jak-Stat signaling cascade pathway and is involved in IL-12-mediated immune regulation. IL-12R beta 1 Protein, Human (HEK293, His) is expressed by HEK293 cells with a C-terminal 6*His tag[1].

Background

The IL-12 receptor is a type I cytokine receptor that binds to IL-12. It is expressed primarily on NK and T cells and consists of beta 1 and beta 2 subunits and is a member of the gp130 cytokine receptor superfamily. IL-12R beta 1 (abbreviated IL-12R1 or IL-12Rβ1) is a subunit of the IL-12 receptor. IL-12R beta 1, also known as CD212 (cluster of differentiation 212), is the name of its human gene. It encodes a type I transmembrane protein belonging to the hematopoietin receptor superfamily. IL-12Rβ1 can form disulfide-linked oligomers, which are required for IL-12 binding activity, and binds to IL-12 with low affinity. In parallel, IL-12Rβ1 protein can be co-expressed with IL-12Rβ2 protein, leading to the formation of high-affinity IL-12 binding sites and the reconstitution of IL-12-dependent signaling[1].
Upon IL-12 binding to the IL-12 receptor, the cytoplasmic protein TYK2, which interacts directly with IL-12Rβ1, and JAK2, which interacts with IL-12Rβ2, are tyrosine phosphorylated. Phosphorylated TYK2 and JAK2 are required for subsequent tyrosine phosphorylation and activation of STAT4, which binds to IL-12Rβ2. STAT4 is a transcription factor that subsequently homodimerizes, translocates to the nucleus and binds to its target DNA to activate transcription of IFN-γ and other target genes. IL-12Rβ1 also binds to IL23R to form the IL-23 receptor, which is involved in IL-23 signaling. It plays a role in IL-23 signaling, possibly through activation of the Jak-Stat signaling cascade. IL-12Rβ1 is expressed in a low intensity constitutive phenotype on the surface of lymphocytes and can be highly upregulated by T cell activation or by stimulation with various interleukins such as IL-2, IL-7 and IL-15. It is also expressed on dendritic cells. Lack of expression of this gene leads to immunodeficiency in patients with severe Mycobacterium and Salmonella infections[2].

In Vitro

IL-12Rβ1-deficient patients are able to develop Th1 T cells, and most Th1 T cell clones (TCCs) are able to respond specifically and consistently to IL-12 by increasing IFN-γ production[1].
IL-12Rβ1 can be expressed on human monocyte-derived dendritic cells (DCs) as well as T cells (TCs) and Con A parent cells, and IL-12Rβ1 is expressed at higher levels on monocyte-derived DCs than on TCs and Con A parent cells. In contrast, little or no IL-12Rβ1 expression is observed in monocytes. IL-12Rβ1 binding to IL-12 induces tyrosine phosphorylation of a variety of intracellular proteins in DCs[3].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-12Rβ1 (C24-E540)
      Accession # P42701-1
    • 6*His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    IL12RB1; Interleukin-12 Receptor Beta-1 Chain; Prev. IL12RB; CD212 Antigen; CD212; IL-12R-Beta-1; Interleukin-12 Receptor Subunit Beta-1; IL-12R-BETA1; Interleukin 12 Receptor, Beta 1; IL-12RB1; IL-12 Receptor Beta Component; IMD30; IL-12 Receptor Subunit

  • AA Sequence

    CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE

  • Predicted Molecular Mass

    58.1 kDa

  • Molecular Weight

    Approximately 64-110 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00