Copy Link Print Information

IL-23 Protein, Rat (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-23 alpha protein has cytokine activity and binds to the interleukin 23 receptor. It regulates cytokine production, lymphocyte activation, and peptidyl tyrosine phosphorylation. IL-23 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-23 Protein, Rat (HEK293, His)
  • Experimental Validation Results for IL-23 Protein, Rat (HEK293, His)
  • IL-23 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-23 alpha protein has cytokine activity and binds to the interleukin 23 receptor. It regulates cytokine production, lymphocyte activation, and peptidyl tyrosine phosphorylation. IL-23 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The IL-23 alpha protein is predicted to possess cytokine activity and contribute to the binding of interleukin-23 receptors. It is also predicted to be involved in various processes, including the positive regulation of cytokine production, lymphocyte activation, and peptidyl-tyrosine phosphorylation. Furthermore, it is anticipated to play a role upstream of T cell proliferation and in the positive regulation of transcription by RNA polymerase II. Located in the extracellular space, this protein is also predicted to be a component of the interleukin-23 complex. In terms of expression, it demonstrates bias toward the thymus (RPKM 15.2), spleen (RPKM 11.9), and nine other tissues. It shares orthology with the human IL23A gene, which is responsible for encoding the interleukin 23 subunit alpha.

Verified Bioactivity

1. Measured by its ability to induce IL17 secretion by mouse splenocytes and the ED50 is 0.5-3 ng/mL.
2. Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED50 for this effect is 4.136 ng/mL, corresponding to a specific activity is 2.41×105 U/mg.
3. Measured by its binding ability in a functional ELISA. Immobilized Rat IL-23R at 10 μg/mL (100 μL/well) on the plate can bind Rat IL-23 Protein. The ED50 for this effect is 0.08-0.3 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED50 for this effect is 4.136 ng/mL, corresponding to a specific activity is 2.41×105 U/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-10*His
  • Accession

    NP_569094.1 (V22-A196) & EDM04146.1 (M23-S335)

  • Gene ID
    155140  [NCBI]&64546  [NCBI]
  • Synonyms

    IL23A; Interleukin 23, Alpha Subunit P19; Interleukin 23 Subunit Alpha; Interleukin-23 Subunit Alpha; SGRF; Interleukin-23 Subunit P19; IL23P19; IL-23 Subunit Alpha; IL-23A; IL-23p19; IL-23; IL-23-A; P19; JKA3 Induced Upon T-Cell Activation; Interleukin-S

  • AA Sequence

    IL-23alpha:
    VPRSSSPDWAQCQQLSRNLCTLAWSAHTPVGQMDLLREEGEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLLPDSPVDQLHTSLLGLSQLLQPEDHHWETQQMPRLSPSQQWQRSLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
    IL-12beta:
    MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

  • Molecular Weight

    Approximately 47 kDa & 43 kDa & 28 kDa & 25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED50 for this effect is 4.136 ng/mL, corresponding to a specific activity is 2.41×105 U/mg.

  • IL-23 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-23 Protein, Rat (HEK293, His)
  • Experimental Validation Results for IL-23 Protein, Rat (HEK293, His)
  • IL-23 Protein, Rat (HEK293, His) Product Image