1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-23
  5. IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His)

IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His)

Cat. No.: HY-P73195
COA Handling Instructions

The IL-23 alpha protein has cytokine activity and binds to interleukin-23 receptors. It regulates cytokine production, lymphocyte activation, and peptidyl-tyrosine phosphorylation. It influences T cell proliferation and RNA polymerase II transcription. Found in the extracellular space, it is part of the interleukin-23 complex. It is mainly expressed in the thymus, spleen, and other tissues. It is orthologous to the human IL23A gene encoding interleukin 23 subunit alpha. IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293, with C-10*His labeled tag. IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His), has molecular weight of ~23 & 43 & 48 kDa, respectively.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $40 In-stock
10 μg $110 In-stock
50 μg $300 In-stock
100 μg $510 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-23 alpha protein has cytokine activity and binds to interleukin-23 receptors. It regulates cytokine production, lymphocyte activation, and peptidyl-tyrosine phosphorylation. It influences T cell proliferation and RNA polymerase II transcription. Found in the extracellular space, it is part of the interleukin-23 complex. It is mainly expressed in the thymus, spleen, and other tissues. It is orthologous to the human IL23A gene encoding interleukin 23 subunit alpha. IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293, with C-10*His labeled tag. IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His), has molecular weight of ~23 & 43 & 48 kDa, respectively.

Background

The IL-23 alpha protein is predicted to possess cytokine activity and contribute to the binding of interleukin-23 receptors. It is also predicted to be involved in various processes, including the positive regulation of cytokine production, lymphocyte activation, and peptidyl-tyrosine phosphorylation. Furthermore, it is anticipated to play a role upstream of T cell proliferation and in the positive regulation of transcription by RNA polymerase II. Located in the extracellular space, this protein is also predicted to be a component of the interleukin-23 complex. In terms of expression, it demonstrates bias toward the thymus (RPKM 15.2), spleen (RPKM 11.9), and nine other tissues. It shares orthology with the human IL23A gene, which is responsible for encoding the interleukin 23 subunit alpha.

Biological Activity

1.Measured by its ability to induce IL17 secretion by mouse splenocytes and the ED50 is 0.5-3 ng/mL.
2. Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED50 for this effect is 4.136 ng/mL, corresponding to a specific activity is 2.41×105 U/mg.

  • Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED50 for this effect is 4.136 ng/mL, corresponding to a specific activity is 2.41×105 U/mg.
Species

Rat

Source

HEK293

Tag

C-10*His

Accession

NP_569094.1 (V22-A196) & EDM04146.1 (M23-S335)

Gene ID
Synonyms
IL-23 p19/IL-12 p40; IL23; IL-23A; Interleukin 23; SGRF
AA Sequence

IL-23alpha:
VPRSSSPDWAQCQQLSRNLCTLAWSAHTPVGQMDLLREEGEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLLPDSPVDQLHTSLLGLSQLLQPEDHHWETQQMPRLSPSQQWQRSLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
IL-12beta:
MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS

Molecular Weight

Approximately 23 & 43 & 48 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-23 alpha & IL-12 beta Heterodimer Protein, Rat (HEK293, His)
Cat. No.:
HY-P73195
Quantity:
MCE Japan Authorized Agent: