IL-36 beta/IL-1F8 Protein, Mouse
Based on 1 Customer Validation
IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 beta/IL-1F8 Protein, Mouse is a recombinant mouse IL-36 beta without any tag, which is produced in E. coli.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 beta/IL-1F8 Protein, Mouse is a recombinant mouse IL-36 beta without any tag, which is produced in E. coli.
Background
IL-36 beta, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta is expressed in monocytes, T/B-lymphocytes, bone-marrow, tonsils, heart, lung, testis, colon, neuron cells, glial cells[3].
The sequence of amino acids in IL-36 beta differs in different species. Mouse IL-36 beta shares <40% aa sequence identity with human.
L-36 beta binds to IL-36R and recruits the co-receptor IL-1RAcP. So that the heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways[1]. But the activation requires N-terminal cleavage at Arg5 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[2]. IL-36β plays a role in the pathogenesis of inflammatory diseases, such as intestinal inflammation[4].
IL-36 beta is a pro-inflammatory factor. IL-36 beta mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[2].
In Vivo
IL-36 beta (mouse) (10 μg/mL, i.p., daily) exacerbates DSS-induce acute colitis mice[4].
IL-36 beta (mouse) (1 μg per mouse) inhibits B16 tumor growth in C57/BL6 mice[5].
Verified Bioactivity
Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 3.909 ng/mL. Corresponding to a specific activity is 2.558×105 U/mg.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9D6Z6 (S31-K183)
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL36B; Interleukin-36 Beta; Prev. IL1F8; MGC126880; IL-1H2; MGC126882; IL-1F8; FIL1 Eta; IL1H2; IL-1 Eta; FILI-(ETA); Interleukin-1 Superfamily E; IL1-ETA; Family Of Interleukin 1-Eta; FIL1; IL-1F8 (FIL1-Eta); Interleukin 1 Family, Member 8 (Eta); FIL1-(E
-
AA Sequence
SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK
-
Predicted Molecular Mass
17.6 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl,1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281(1):169-178. [Content Brief]
[2]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210. [Content Brief]
[3]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65. [Content Brief]
[4]. Zhu J, et al. Interleukin-36β exacerbates DSS-induce acute colitis via inhibiting Foxp3+ regulatory T cell response and increasing Th2 cell response. Int Immunopharmacol. 2022 Jul;108:108762. [Content Brief]
[5]. Zhao X, et al. IL-36β Promotes CD8+ T Cell Activation and Antitumor Immune Responses by Activating mTORC1. Front Immunol. 2019 Aug 7;10:1803. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
