IL-36 beta/IL-1F8 Protein, Mouse

Customer Review

Based on 1 Customer Validation

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases. IL-36 beta/IL-1F8 Protein, Mouse is a recombinant mouse IL-36 beta without any tag, which is produced in E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 beta/IL-1F8 Protein, Mouse is a recombinant mouse IL-36 beta without any tag, which is produced in E. coli.

Background

IL-36 beta, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta is expressed in monocytes, T/B-lymphocytes, bone-marrow, tonsils, heart, lung, testis, colon, neuron cells, glial cells[3].
The sequence of amino acids in IL-36 beta differs in different species. Mouse IL-36 beta shares <40% aa sequence identity with human.
L-36 beta binds to IL-36R and recruits the co-receptor IL-1RAcP. So that the heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways[1]. But the activation requires N-terminal cleavage at Arg5 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3[2]. IL-36β plays a role in the pathogenesis of inflammatory diseases, such as intestinal inflammation[4].
IL-36 beta is a pro-inflammatory factor. IL-36 beta mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway[2].

In Vivo

IL-36 beta (mouse) (10 μg/mL, i.p., daily) exacerbates DSS-induce acute colitis mice[4].
IL-36 beta (mouse) (1 μg per mouse) inhibits B16 tumor growth in C57/BL6 mice[5].

Verified Bioactivity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 3.909 ng/mL. Corresponding to a specific activity is 2.558×105 U/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 3.909 ng/mL. Corresponding to a specific activity is 2.558×105 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL36B; Interleukin-36 Beta; Prev. IL1F8; MGC126880; IL-1H2; MGC126882; IL-1F8; FIL1 Eta; IL1H2; IL-1 Eta; FILI-(ETA); Interleukin-1 Superfamily E; IL1-ETA; Family Of Interleukin 1-Eta; FIL1; IL-1F8 (FIL1-Eta); Interleukin 1 Family, Member 8 (Eta); FIL1-(E

  • AA Sequence

    SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK

  • Predicted Molecular Mass

    17.6 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl,1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00