IL-36 beta/IL-1F8 Protein, Mouse (153a.a)

IL-36 beta (IL-1F8), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases^[1][2]. IL-36 beta/IL-1F8 Protein, Mouse (153a.a) is a recombinant mouse IL-36 beta (S31-K183) without any tag, which is produced in E. coli.

IL-36 beta, a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 beta is expressed in monocytes, T/B-lymphocytes, bone-marrow, tonsils, heart, lung, testis, colon, neuron cells, glial cells^[3].
The sequence of amino acids in IL-36 beta differs in different species. Mouse IL-36 beta shares <40% aa sequence identity with human.
L-36 beta binds to IL-36R and recruits the co-receptor IL-1RAcP. So that the heterodimeric signaling complex brings Toll/IL-1R (TIR) domains of the 2 receptor chains in close proximity, and thereby activating NF-κB and MAPK signaling pathways^[1]. But the activation requires N-terminal cleavage at Arg5 by neutrophil granule-derived proteases, such as cathepsin G, elastase and proteinase-3^[2]. IL-36β plays a role in the pathogenesis of inflammatory diseases, such as intestinal inflammation^[4].
IL-36 beta is a pro-inflammatory factor. IL-36 beta mediates inflammatory response through the activation of NF-κB and MAPK signaling pathway^[2].

IL-36 beta (mouse) (10 μg/mL, i.p., daily) exacerbates DSS-induce acute colitis mice^[4].
IL-36 beta (mouse) (1 μg per mouse) inhibits B16 tumor growth in C57/BL6 mice^[5].

Mouse

E. coli

Tag Free

Q9D6Z6 (S31-K183)

69677  [NCBI]

SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK

Approximately 16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris,150 mM NaCl,1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Bassoy EY, et al. Regulation and function of interleukin-36 cytokines. Immunol Rev. 2018 Jan;281(1):169-178.  [Content Brief]

  [2]. Zhou L,et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.  [Content Brief]

  [3]. Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25(6):458-65.  [Content Brief]

  [4]. Zhu J, et al. Interleukin-36β exacerbates DSS-induce acute colitis via inhibiting Foxp3+ regulatory T cell response and increasing Th2 cell response. Int Immunopharmacol. 2022 Jul;108:108762.  [Content Brief]

  [5]. Zhao X, et al. IL-36β Promotes CD8+ T Cell Activation and Antitumor Immune Responses by Activating mTORC1. Front Immunol. 2019 Aug 7;10:1803.  [Content Brief]