Copy Link Print Information

IL-37 Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-37 Protein, Human
  • Experimental Validation Results for IL-37 Protein, Human
  • IL-37 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.

Background

IL-37 Protein, an immune regulatory cytokine, plays a pivotal role as a suppressor of innate inflammatory and immune responses, mitigating excessive inflammation. Signaling occurs through two distinct mechanisms: intracellularly via nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor, composed of IL18R1 and IL18RAP. IL-37 suppresses or reduces the production of pro-inflammatory cytokines, including IL1A, IL6, CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A, and IL1RN, while sparing anti-inflammatory cytokines. It also inhibits dendritic cell activation. IL-37 interacts with SMAD3 and binds IL18R1, albeit with lower affinity than IL18, without acting as a receptor antagonist for IL18. Additionally, it forms a complex with the cargo receptor TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.

Verified Bioactivity

Immobilized Recombinant human IL-18 R alpha /IL-1 R5 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant human IL-37 Protein. The ED50 for this effect is <512 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9NZH6-1 (K53-D218)

  • Gene ID
    27178  [NCBI]
  • Molecular Construction
    • N-term
    • IL-37 (K53-D218)
      Accession # Q9NZH6-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL37; IL1RP1; Prev. IL1F7; IL-37; IL-1RP1; IL1H4; IL-1H4; Interleukin 1 Family, Member 7 (Zeta); IL-1F7; IL1F7 (Canonical Product IL-1F7b); FIL1Z; IL-1F7b (IL-1H4, IL-1H, IL-1RP1); Interleukin-1-Related Protein; Interleukin 1 Family Member 7; Interleukin-

  • AA Sequence

    KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

  • Predicted Molecular Mass

    18.7 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Lijuan Wang, et al. Interleukin-37: A crucial cytokine with multiple roles in disease and potentially clinical therapy. Oncol Lett. 2018 Apr;15(4):4711-4719. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Recombinant human IL-18 R alpha /IL-1 R5 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant human IL-37 Protein. The ED50 for this effect is 484.2 ng/mL.

  • IL-37 Protein, Human Product Image
    1/16
  • Experimental Validation Results for IL-37 Protein, Human
  • Experimental Validation Results for IL-37 Protein, Human
  • IL-37 Protein, Human Product Image