1. Recombinant Proteins
  2. IL-37 Protein, Human

IL-37 Protein, Human

Cat. No.: HY-P70455
Handling Instructions

IL-37 Protein, Human, a recombinant human IL-37 expresses in E. coli. IL-37 plays a vital role in inhibiting both innate and adaptive immune responses as well as inflammatory reactions[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $180 In-stock
Estimated Time of Arrival: December 31
50 μg $540 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Interleukin-37; FIL1 Zeta; IL-1X; Interleukin-1 Family Member 7; IL-1F7; Interleukin-1 Homolog 4; IL-1H; IL-1H4; Interleukin-1 Zeta; IL-1 Zeta; Interleukin-1-Related Protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1
Species

Human

Source

E. coli

Accession

Q9NZH6 (K53-D218)

Gene ID

27178

Molecular Weight

Approximately 18.0 kDa

AA Sequence

KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
2 μg/mL (100 μL/well) of immobilized Human IL-37 can bind Human IL-18RAP-Fc with an ED50 value of 0.5-2.5 μg/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

[1]

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-37 Protein, Human
Cat. No.:
HY-P70455
Quantity:
MCE Japan Authorized Agent: