1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-37
  5. IL-37 Protein, Human

IL-37 Protein, Human

Cat. No.: HY-P70455
COA Handling Instructions

IL-37 Protein, Human, a recombinant human IL-37 expresses in E. coli. IL-37 plays a vital role in inhibiting both innate and adaptive immune responses as well as inflammatory reactions.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $40 In-stock
5 μg $75 In-stock
10 μg $120 In-stock
50 μg $350 In-stock
100 μg $600 In-stock
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-37 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-37 Protein, Human, a recombinant human IL-37 expresses in E. coli. IL-37 plays a vital role in inhibiting both innate and adaptive immune responses as well as inflammatory reactions[1].

Biological Activity

Immobilized Recombinant human IL-18 R alpha /IL-1 R5 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant human IL-37 Protein. The ED50 for this effect is <512 ng/mL.

  • Immobilized Recombinant human IL-18 R alpha /IL-1 R5 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant human IL-37 Protein. The ED50 for this effect is 484.2 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NZH6 (K53-D218)

Gene ID
Synonyms
Interleukin-37; FIL1 Zeta; IL-1X; Interleukin-1 Family Member 7; IL-1F7; Interleukin-1 Homolog 4; IL-1H; IL-1H4; Interleukin-1 Zeta; IL-1 Zeta; Interleukin-1-Related Protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1
AA Sequence

KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Molecular Weight

Approximately 18-20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-37 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-37 Protein, Human
Cat. No.:
HY-P70455
Quantity:
MCE Japan Authorized Agent: