1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-4
  5. IL-4 Protein, Mouse

IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    IL-4 Protein, Mouse purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Nov 6:e15664.  [Abstract]

    Flow cytometric analysis of CD86 and CD206 expression in RAW264.7 cells and corresponding quantification (n = 3). M2 polarization of RAW264.7 cells was induced by treatment with recombinant IL-4 (20 ng/mL) for 24 h.

    IL-4 Protein, Mouse purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2024 Dec 12:e2410495.  [Abstract]

    Flow cytometric analyzed the effect of IL-4 (20 ng/mL; 48 h)/IL-13 (40 ng/mL; 48 h) stimulation on M2 polarization of macrophages , and statistical analysis.

    IL-4 Protein, Mouse purchased from MCE. Usage Cited in: Cell Rep. 2025 Apr 9;44(4):115542.  [Abstract]

    Mean currents elicited by membrane stretch (bottom traces) and recorded in the cell-attached configuration at −80 mV in BMDMs polarized to M2. BMDM M0 cells were first polarized to M2 in complete medium supplemented with IL-4 (20 ng/mL, HY-P70644) and IL-13 (20 ng/mL) cocktail for 24 h, and then treated with either EtOH (black traces) or 10 μM 7-KC (in red) for an additional 24 h in LDL-free medium. Left inset: M2 polarization was confirmed by CD206 gene expression and is represented as relative expression to TOP1. Right insets: peak current amplitude in EtOH (in black) or 7-KC (in red) condition, comparing WT and KO macrophages. n, number of individual recordings are shown above the traces. N = 2, number of animals from each genotype used for isolation of bone marrow mesenchymal stem cells and differentiation to macrophages.

    IL-4 Protein, Mouse purchased from MCE. Usage Cited in: J Agric Food Chem. 2024 May 16.  [Abstract]

    Cell viability of microglia treated with ox-LDL (12.5 μg/mL), FAC (200 μM), RSL3 (1 μM), erastin (5 μM), LPS (10 ng/mL), or IL-4 (10 ng/mL) for 24 h.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    IL-4 Protein is a pleiotropic cytokine secreted by immune cells such as Th2. IL-4 Protein is involved in various processes, including humoral immunity, Th cell differentiation, allergic reactions, and inflammatory responses. IL-4 Protein plays a key role in immune responses and inflammatory reactions. IL-4 Protein, Mouse is a recombinant IL-4 protein expressed by E. coli without a tag[1][2][3].

    Background

    IL-4 is a core cytokine of the Th2-type immune response. As a pleiotropic cytokine, IL-4 is secreted by various cells such as Th2 cells, NKT cells, and mast cells. By binding to type I and type II receptors, IL-4 activates signaling pathways including JAK-STAT6, playing a central role in Th2 cell differentiation, B-cell immunoglobulin class switching (such as the production of IgE and IgG1), and M2 macrophage polarization. Aberrant expression of IL-4 is closely associated with allergic diseases like asthma and atopic dermatitis, as well as immune responses to parasitic infections[1][2][3].

    In Vitro

    IL-4 Protein (Mouse; 0-10 ng/mL; 0-10 days) can prolong the survival time of mouse peritoneal exudate macrophages (PEM) in vitro. When used in combination with M-CSF (HY-P7050), it promotes cell proliferation, while when used in combination with GM-CSF (HY-P7361), it inhibits cell proliferation[4].
    IL-4 Protein (Mouse; 0-50 ng/mL; 48-120 h) can induce the proliferation of lymph node cells in BALB/c mice and induce Th2 differentiation and IL-4 production in CD4+ T cells of BALB/c mice[5].

    In Vivo

    IL-4 protein (Mouse; 0.5-5 μg/kg; subcutaneous injection; 30 days) can improve psoriatic-like phenotypes, reduce inflammatory cell infiltration, decrease the expression of adhesion molecules, and exhibit activities in improving angiogenesis and inflammation in K14-VEGF transgenic mice[6].

    Biological Activity

    1. Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED50 for this effect is ≤250 pg/mL.
    2. Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×105 units/mg.

    • Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P07750 (H23-S140)

    Gene ID
    Molecular Construction
    N-term
    IL-4 (H23-S140)
    Accession # P07750
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; Lymphocyte stimulatory factor 1; IL-4; BSF-1
    AA Sequence

    HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

    Predicted Molecular Mass
    13.4 kDa
    Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 5% trehalose, pH 6.5.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    IL-4 Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    IL-4 Protein, Mouse

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    IL-4 Protein, Mouse
    Cat. No.:
    HY-P70644
    Quantity:
    MCE Japan Authorized Agent: