Copy Link Print Information

M-CSF Protein, Human

23 Cited Publications
Customer Review

Based on 23 publication(s) in Google Scholar

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis. M-CSF Protein, Human is a recombinant human M-CSF protein expressed in E. coli with tag-free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for M-CSF Protein, Human
  • Experimental Validation Results for M-CSF Protein, Human
  • M-CSF Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human is a recombinant human M-CSF protein expressed in E. coli with tag-free.

Background

1. M-CSF Protein Protein Characteristics[1][2][3]
M-CSF, or macrophage colony stimulating factor, CSF-1, is a disulfide-linked homodimer belonging to the colony stimulating factor (CSF) family. M-CSF is a hematopoietic growth factor and proinflammatory cytokine with multiple glycosylation sites, belonging to the hematopoietic growth factor family along with GM-CSF and G-CSF. M-CSF affects the survival and function of tissue macrophages and has anti-tumor activity[1]. M-CSF is expressed in a variety of cells, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, and has multiple subtypes. M-CSF can be a secreted glycoprotein, a cell surface protein and a proteoglycan, binding to its receptor CSF1R[2]. M-CSF can specifically act on the monocyte-macrophage lineage, participate in the development and proliferation of monocyte/macrophage lineage cells, and participate in the induction of osteoclasts. Osteoclasts are very important for the destruction of bone and cartilage and the changes in periarticular osteoporosis in patients with rheumatoid arthritis[3].
2. M-CSF Protein Functional Characteristics[1][4]
M-CSF is regulated by LPS and IFN-γ upstream, and activates NF-κB and STAT3 downstream, regulating inflammatory factors such as IL-12 and TNF-α. M-CSF induces macrophage polarization to M1 type, and enhances antibody-dependent cellular cytotoxicity (ADCC) by upregulating surface molecules such as CD80 and CD16, exerting anti-tumor effects. M-CSF may induce macrophage polarization to M2 type, promoting VEGF secretion and angiogenesis.
3. Application of M-CSF Protein[1][4][5][6]
Oncology: Clinical trials have shown that M-CSF combined with monoclonal antibodies can enhance tumor-targeted killing, but its pro-angiogenic effect may promote metastasis.
Infection and Immunity: Enhance the antifungal (such as Candida) and anti-tuberculosis activity of macrophages, and use it to treat infections in immunocompromised patients.
Hematopoietic Repair: Restore monocyte counts after chemotherapy/transplantation and shorten the neutrophil deficiency period.
Bone Disease: Regulate osteoclasts, used in osteoporosis and rheumatoid arthritis research.

Verified Bioactivity

The ED50 is 0.4-3.0 ng/mL as measured by M-NFS-60 cells, corresponding to a specific activity of 3.3 × 105-2.5 × 106 units/mg.

Results
  • Experimental Validation Results for M-CSF Protein, Human
    Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.9490 ng/mL, corresponding to a specific activity is 1.053×106 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P09603-3 (E33-S190)

  • Gene ID
    1435  [NCBI]
  • Molecular Construction
    • N-term
    • M-CSF (E33-S190)
      Accession # P09603-3
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rHuM-CSF; CSF-1; MGI-IM

  • AA Sequence

    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

  • Molecular Weight

    Approximately 18 kDa under reduced (R) conditions, 28 kDa under non reducing (N) conditions, based on SDS-PAGE, due to the glycosylation.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for M-CSF Protein, Human
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS or Tris-HCl, pH 8.0. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF). Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71. [Content Brief]

[2]. Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8(7):533-44. [Content Brief]

[3]. Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58(8):2257-67. [Content Brief]

[4]. Eubank TD, et al. M-CSF induces vascular endothelial growth factor production and angiogenic activity from human monocytes. J Immunol. 2003 Sep 1;171(5):2637-43. [Content Brief]

[5]. Jaguin M, et al. Polarization profiles of human M-CSF-generated macrophages and comparison of M1-markers in classically activated macrophages from GM-CSF and M-CSF origin. Cell Immunol. 2013 Jan;281(1):51-61. [Content Brief]

[6]. Sakurai T, et al. Effect of macrophage colony-stimulating factor (M-CSF) on mouse immune responses in vivo. Immunopharmacol Immunotoxicol. 1998 Feb;20(1):79-102. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.9490 ng/mL, corresponding to a specific activity is 1.053×106 U/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.9490 ng/mL, corresponding to a specific activity is 1.053×106 U/mg.

  • M-CSF Protein, Human Product Image
    1/16
  • Experimental Validation Results for M-CSF Protein, Human
  • Experimental Validation Results for M-CSF Protein, Human
  • M-CSF Protein, Human Product Image