Copy Link Print Information

M-CSF Protein, Mouse (HEK293)

7 Cited Publications
Customer Review

Based on 7 publication(s) in Google Scholar

M-CSF Protein, Mouse (HEK293) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293)
  • M-CSF Protein, Mouse (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

M-CSF Protein, Mouse (HEK293) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

Background

Macrophage Colony Stimulating Factor (M-CSF) is a pro-inflammatory cytokine, constitutively produced by several cell types, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, binds to its receptor CSF1R, and exists in several isoforms- as a secreted glycoprotein, a cell-surface protein and a proteoglycan[1]. M-CSF is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts, which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes seen in patients with rheumatoid arthritis[2].

Verified Bioactivity

1.The cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells with an ED50 value of ≤15 ng/mL.
2.Immobilized mouse CSF1 at 2 μg/mL (100 μl/well) can bind mouse CSF1R-Fch, The EC50 of mouse CSF1R-Fch is 60-220 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    P07141-1 (K33-E262)

  • Gene ID
    12977  [NCBI]
  • Molecular Construction
    • N-term
    • M-CSF (K33-E262)
      Accession # P07141
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo

  • AA Sequence

    KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

  • Predicted Molecular Mass

    26 kDa

  • Molecular Weight

    Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8(7):533-44. [Content Brief]

[2]. Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58(8):2257-67. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.6303 ng/mL , corresponding to a specific activity is 1.586×106 units/mg.

  • M-CSF Protein, Mouse (HEK293) Product Image
    1/16
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293)
  • M-CSF Protein, Mouse (HEK293) Product Image