1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Mouse (HEK293)

M-CSF Protein, Mouse (HEK293) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
5 μg En stock
10 μg En stock
20 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

M-CSF Protein, Mouse (HEK293) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

Background

Macrophage Colony Stimulating Factor (M-CSF) is a pro-inflammatory cytokine, constitutively produced by several cell types, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, binds to its receptor CSF1R, and exists in several isoforms- as a secreted glycoprotein, a cell-surface protein and a proteoglycan[1]. M-CSF is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts, which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes seen in patients with rheumatoid arthritis[2].

Actividad biológica

1.The cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells with an ED50 value of ≤15 ng/mL.
2.Immobilized mouse CSF1 at 2 μg/mL (100 μl/well) can bind mouse CSF1R-Fch, The EC50 of mouse CSF1R-Fch is 60-220 ng/mL.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.6303 ng/mL , corresponding to a specific activity is 1.586×106 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P07141-1 (K33-E262)

Gene ID
Molecular Construction
N-term
M-CSF (K33-E262)
Accession # P07141
C-term
Protein Length

Partial

Synonyms
Macrophage colony-stimulating factor 1; CSF-1; MCSF; Csf1; Csfm
AA Sequence

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Predicted Molecular Mass
26 kDa
Peso molecular

Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

M-CSF Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

M-CSF Protein, Mouse (HEK293)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
M-CSF Protein, Mouse (HEK293)
Cat. No.:
HY-P70553
Cantidad:
MCE Japan Authorized Agent: