Copy Link Print Information

IL-13 Protein, Mouse

26 Cited Publications
Customer Review

Based on 26 publication(s) in Google Scholar

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-13 Protein, Mouse
  • Experimental Validation Results for IL-13 Protein, Mouse
  • Experimental Validation Results for IL-13 Protein, Mouse
  • Experimental Validation Results for IL-13 Protein, Mouse
  • IL-13 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-13 Protein, Mouse is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8[1].

Background

IL-13 is a potent down-modulator of macrophage proinflammatory activity in vitro, similar in this context to the anti-inflammatory cytokines IL-4 and IL-10[1].

Verified Bioactivity

The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of <3 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P20109 (S26-F131)

  • Gene ID
    16163  [NCBI]
  • Molecular Construction
    • N-term
    • IL-13 (S26-F131)
      Accession # P20109
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788

  • AA Sequence

    SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

  • Predicted Molecular Mass

    11.7 kDa

  • Molecular Weight

    Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 8% Trehalose, 4% Mannitol, 50 mM NaCl, 0.05% Tween 80, pH 6.0.
2.Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. T Muchamuel, et al. IL-13 protects mice from lipopolysaccharide-induced lethal endotoxemia: correlation with down-modulation of TNF-alpha, IFN-gamma, and IL-12 production. J Immunol. 1997 Mar 15;158(6):2898-903. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 1.876 ng/mL, corresponding to a specific activity is 5.330×105 U/mg.

  • 1/16

    IL-13 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jul 7;320(Pt 2):145830. [Abstract]

    Customer Validation
     IL-13, Mouse (20 ng/mL; 12 h). M2 cell marker CD206 is determined using the immunofluorescence method. The results indicates that the IL4 and IL-13 induced M2 type clearly expresses higher CD206 in contrast to the blank control.

  • 1/16

    IL-13 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Oct 28;25(1):496. [Abstract]

    Customer Validation
     A: The qPCR was used to detect miR-30a-5p level in mouse bronchial epithelial cells. B, C: Western blot was used to measure E-cadherin, α-SMA, and Vimentin protein expressions in mouse bronchial epithelial cells. Protein blot was analyzed by ImageJ. 10 ng/mL IL-13 and 10 ng/mL IL-4 were used to induce EMT by incubating BECs for 48 h.

  • IL-13 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IL-13 Protein, Mouse
  • Experimental Validation Results for IL-13 Protein, Mouse
  • Experimental Validation Results for IL-13 Protein, Mouse
  • Experimental Validation Results for IL-13 Protein, Mouse
  • IL-13 Protein, Mouse Product Image

  • IL-13 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Jul 7;320(Pt 2):145830. [Abstract]

    IL-13, Mouse (20 ng/mL; 12 h). M2 cell marker CD206 is determined using the immunofluorescence method. The results indicates that the IL4 and IL-13 induced M2 type clearly expresses higher CD206 in contrast to the blank control.

  • IL-13 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Oct 28;25(1):496. [Abstract]

    A: The qPCR was used to detect miR-30a-5p level in mouse bronchial epithelial cells. B, C: Western blot was used to measure E-cadherin, α-SMA, and Vimentin protein expressions in mouse bronchial epithelial cells. Protein blot was analyzed by ImageJ. 10 ng/mL IL-13 and 10 ng/mL IL-4 were used to induce EMT by incubating BECs for 48 h.