Copy Link Print Information

IL-10 Protein, Mouse

6 Cited Publications
Customer Review

Based on 6 publication(s) in Google Scholar

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • IL-10 Protein, Mouse Product Image
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • IL-10 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free.

Background

IL-10, a major immune regulatory cytokine, exerts profound anti-inflammatory functions, mitigating excessive tissue disruption caused by inflammation. Upon binding to its heterotetrameric receptor, comprising IL10RA and IL10RB, IL-10 initiates a signaling cascade involving JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, where it drives the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, inhibiting their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby dampening their ability to induce T cell activation. Furthermore, IL-10 controls the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. IL-10 exists as a homodimer and interacts with IL10RA and IL10RB.

Verified Bioactivity

Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is <5 ng/mL in the presence of 2 μg/mL LPS.

Results
  • Experimental Validation Results for IL-10 Protein, Mouse
    Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.3491 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.865×106 U/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P18893 (S19-S178)

  • Gene ID
    16153  [NCBI]
  • Molecular Construction
    • N-term
    • IL-10 (S19-S178)
      Accession # P18893
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Interleukin-10; Il10; IL-10; Cytokine synthesis inhibitory factor; CSIF

  • AA Sequence

    SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

  • Predicted Molecular Mass

    18.9 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for IL-10 Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial)
=
Mass (in vial)
÷
Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start)
×
Volume (start)
=
Concentration (final)
×
Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50)
106 ÷
ng/mL

IL-10 Protein, Mouse Related Classifications

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.3491 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.865×106 U/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.3491 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.865×106 U/mg.

  • 1/16

    IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Customer Validation
     IL-10 (1 ng/mL, 24 h) reversed the increase in intracellular S. aureus growth within BMDMs induced by IL-10 siRNA treatment.

  • 1/16

    IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Customer Validation
     Flow cytometry analysis of mtROS levels in BMDMs 24 h post-infection with GFP-S. aureus (MOI = 10), following transfection with either control siRNA or IL-10 siRNA, with or without the addition of IL-10 (1 ng/mL). Quantitative analysis of the Mean Fluorescence Intensity (MFI) reflects the intracellular mtROS levels.

  • 1/16

    IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Customer Validation
     Flow cytometry analysis of the impact of Mdivi-1 (20µM) pretreatment, with or without added IL10 (1ng/ml), on the bacterial load of BMDMs infected with GFP-S. aureus (MOI = 10) for 24 h. Quantitative analysis of the proportion of BMDMs infected with GFP-S. aureus.

  • 1/16

    IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Customer Validation
     Flow cytometry analysis of mtROS levels in BMDMs 24 h after infection with S. aureus (MOI = 10) in various treatment groups. Quantitative analysis of intracellular mtROS levels (IL-10:1 ng/mL, 24 h,Mdivi-1:20 µM, 24 h).

  • 1/16

    IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Cancer. 2023 Oct 30;23(1):1042. [Abstract]

    Customer Validation
     M1 macrophages had increased adropin production as stimulated by LPS/IFN-γ, but M2 macrophages had decreased adropin production after being treated by IL-4 (50 ng/mL), IL-10 (50 ng/mL), or TGF-β1

  • IL-10 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • Experimental Validation Results for IL-10 Protein, Mouse
  • IL-10 Protein, Mouse Product Image

  • IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    IL-10 (1 ng/mL, 24 h) reversed the increase in intracellular S. aureus growth within BMDMs induced by IL-10 siRNA treatment.

  • IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Flow cytometry analysis of mtROS levels in BMDMs 24 h post-infection with GFP-S. aureus (MOI = 10), following transfection with either control siRNA or IL-10 siRNA, with or without the addition of IL-10 (1 ng/mL). Quantitative analysis of the Mean Fluorescence Intensity (MFI) reflects the intracellular mtROS levels.

  • IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Flow cytometry analysis of the impact of Mdivi-1 (20µM) pretreatment, with or without added IL10 (1ng/ml), on the bacterial load of BMDMs infected with GFP-S. aureus (MOI = 10) for 24 h. Quantitative analysis of the proportion of BMDMs infected with GFP-S. aureus.

  • IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156. [Abstract]

    Flow cytometry analysis of mtROS levels in BMDMs 24 h after infection with S. aureus (MOI = 10) in various treatment groups. Quantitative analysis of intracellular mtROS levels (IL-10:1 ng/mL, 24 h,Mdivi-1:20 µM, 24 h).

  • IL-10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: BMC Cancer. 2023 Oct 30;23(1):1042. [Abstract]

    M1 macrophages had increased adropin production as stimulated by LPS/IFN-γ, but M2 macrophages had decreased adropin production after being treated by IL-4 (50 ng/mL), IL-10 (50 ng/mL), or TGF-β1