1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-10
  5. IL-10 Protein, Mouse

IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

    IL-10 Protein, Mouse purchased from MCE. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156.  [Abstract]

    IL-10 (1 ng/mL, 24 h) reversed the increase in intracellular S. aureus growth within BMDMs induced by IL-10 siRNA treatment.

    IL-10 Protein, Mouse purchased from MCE. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156.  [Abstract]

    Flow cytometry analysis of mtROS levels in BMDMs 24 h post-infection with GFP-S. aureus (MOI = 10), following transfection with either control siRNA or IL-10 siRNA, with or without the addition of IL-10 (1 ng/mL). Quantitative analysis of the Mean Fluorescence Intensity (MFI) reflects the intracellular mtROS levels.

    IL-10 Protein, Mouse purchased from MCE. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156.  [Abstract]

    Flow cytometry analysis of the impact of Mdivi-1 (20µM) pretreatment, with or without added IL10 (1ng/ml), on the bacterial load of BMDMs infected with GFP-S. aureus (MOI = 10) for 24 h. Quantitative analysis of the proportion of BMDMs infected with GFP-S. aureus.

    IL-10 Protein, Mouse purchased from MCE. Usage Cited in: J Transl Med. 2025 Feb 4;23(1):156.  [Abstract]

    Flow cytometry analysis of mtROS levels in BMDMs 24 h after infection with S. aureus (MOI = 10) in various treatment groups. Quantitative analysis of intracellular mtROS levels (IL-10:1 ng/mL, 24 h,Mdivi-1:20 µM, 24 h).

    IL-10 Protein, Mouse purchased from MCE. Usage Cited in: BMC Cancer. 2023 Oct 30;23(1):1042.  [Abstract]

    M1 macrophages had increased adropin production as stimulated by LPS/IFN-γ, but M2 macrophages had decreased adropin production after being treated by IL-4 (50 ng/mL), IL-10 (50 ng/mL), or TGF-β1
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    Descripciòn

    IL-10 protein is a key immunomodulator that, by binding to its heterotetrameric receptors (IL10RA and IL10RB), activates JAK1 and STAT2 (the latter phosphorylates STAT3), thereby triggering potent anti-inflammatory effects. Phosphorylated STAT3 translocates to the nucleus and promotes the expression of anti-inflammatory mediators. IL-10 Protein, Mouse is the recombinant mouse-derived IL-10 protein, expressed by E. coli , with tag free.

    Background

    IL-10, a major immune regulatory cytokine, exerts profound anti-inflammatory functions, mitigating excessive tissue disruption caused by inflammation. Upon binding to its heterotetrameric receptor, comprising IL10RA and IL10RB, IL-10 initiates a signaling cascade involving JAK1 and STAT2-mediated phosphorylation of STAT3. Subsequently, phosphorylated STAT3 translocates to the nucleus, where it drives the expression of anti-inflammatory mediators. IL-10 specifically targets antigen-presenting cells (APCs), such as macrophages and monocytes, inhibiting their release of pro-inflammatory cytokines, including GM-CSF, G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8, and TNF-alpha. Additionally, IL-10 interferes with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby dampening their ability to induce T cell activation. Furthermore, IL-10 controls the inflammatory response of macrophages by reprogramming essential metabolic pathways, including mTOR signaling. IL-10 exists as a homodimer and interacts with IL10RA and IL10RB.

    Actividad biológica

    Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is <5 ng/mL in the presence of 2 μg/mL LPS.

    • Mouse IL-10 inhibits LPS-induced secretion of IL-6 by RAW264.7 cells. The ED50 for this effect is 0.3491 ng/mL in the presence of 2 μg/mL LPS. Corresponding to a specific activity is 2.865×106 U/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P18893 (S19-S178)

    Gene ID
    Molecular Construction
    N-term
    IL-10 (S19-S178)
    Accession # P18893
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    Interleukin-10; Il10; IL-10; Cytokine synthesis inhibitory factor; CSIF
    AA Sequence

    SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

    Predicted Molecular Mass
    18.9 kDa
    Peso molecular

    Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions.

    Pureza
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <0.01 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación

    IL-10 Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    IL-10 Protein, Mouse

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    IL-10 Protein, Mouse
    Cat. No.:
    HY-P70517
    Cantidad:
    MCE Japan Authorized Agent: