Copy Link Print Information

IL-4 Protein, Mouse (HEK293, His)

13 Cited Publications
Customer Review

Based on 13 publication(s) in Google Scholar

IL-4 Protein, Mouse (HEK293, His) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression.IL-4 Protein, Mouse (HEK293, His) is a recombinant mouse interleukin-4 (rhIL-4) expressed in HEK 293 cells with a His tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • IL-4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-4 Protein, Mouse (HEK293, His) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression.IL-4 Protein, Mouse (HEK293, His) is a recombinant mouse interleukin-4 (rhIL-4) expressed in HEK 293 cells with a His tag.

Background

IL-4 is a T cell-derived growth factor for B cells. In addition to T cells, IL-4 is produced by innate lymphocytes, such as NTK cells, and myeloid cells, such as basophils and mast cells. It is a signature cytokine of type 2 immune response but also has a nonimmune function. Its expression is tightly regulated at several levels, including signaling pathways, transcription factors, epigenetic modifications, microRNA, and long noncoding RNA. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy[1].

Verified Bioactivity

1.Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED50 for this effect is <80 pg/mL.
2.Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P07750 (H21-S140)

  • Gene ID
    16189  [NCBI]
  • Molecular Construction
    • N-term
    • IL-4 (H21-S140)
      Accession # P07750
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1

  • AA Sequence

    HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

  • Predicted Molecular Mass

    14.6 kDa

  • Molecular Weight

    Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. I-Cheng Ho,et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HT-2 cells. The ED50 for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×105 units/mg.

  • 1/16

    IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Biol Proced Online. 2025 May 22;27(1):18. [Abstract]

    Customer Validation
     IL-4 (20 ng/mL)-induced macrophages exhibited a spindle shape with pseudopodia, like the morphology observed in macrophages within the co-culture system.

  • 1/16

    IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Biol Proced Online. 2025 May 22;27(1):18. [Abstract]

    Customer Validation
     Both IL-4 (20 ng/mL) treatment and co-culture conditions increased the proportion of F4/80+CD206+ macrophages compared to the control, indicating M2 polarization

  • 1/16

    IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Oct 28;25(1):496. [Abstract]

    Customer Validation
     A: The qPCR was used to detect miR-30a-5p level in mouse bronchial epithelial cells. B, C: Western blot was used to measure E-cadherin, α-SMA, and Vimentin protein expressions in mouse bronchial epithelial cells. Protein blot was analyzed by ImageJ. 10 ng/mL IL-13 and 10 ng/mL IL-4 were used to induce EMT by incubating BECs for 48 h.

  • 1/16

    IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Nephrol Dial Transplant. 2024 Jul 31;39(8):1344-1359. [Abstract]

    Customer Validation
     Representative images of polarization models of M1 macrophage and M2 macrophage by flow cytometry in vitro. The RAW264.7 cells were treated with LPS (100 ng/ml) and INF-r (10 ng/ml) for 24 hours to induce M1 macrophage polarization, while IL-4 (20 ng/ml) for 24 hours to induce M2 macrophage polarization.

  • 1/16

    IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Cancer. 2023 Oct 30;23(1):1042. [Abstract]

    Customer Validation
     M1 macrophages had increased adropin production as stimulated by LPS/IFN-γ, but M2 macrophages had decreased adropin production after being treated by IL-4 (50 ng/mL), IL-10 (50 ng/mL), or TGF-β1

  • IL-4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-4 Protein, Mouse (HEK293, His)
  • IL-4 Protein, Mouse (HEK293, His) Product Image

  • IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Biol Proced Online. 2025 May 22;27(1):18. [Abstract]

    IL-4 (20 ng/mL)-induced macrophages exhibited a spindle shape with pseudopodia, like the morphology observed in macrophages within the co-culture system.

  • IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Biol Proced Online. 2025 May 22;27(1):18. [Abstract]

    Both IL-4 (20 ng/mL) treatment and co-culture conditions increased the proportion of F4/80+CD206+ macrophages compared to the control, indicating M2 polarization

  • IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Pulm Med. 2025 Oct 28;25(1):496. [Abstract]

    A: The qPCR was used to detect miR-30a-5p level in mouse bronchial epithelial cells. B, C: Western blot was used to measure E-cadherin, α-SMA, and Vimentin protein expressions in mouse bronchial epithelial cells. Protein blot was analyzed by ImageJ. 10 ng/mL IL-13 and 10 ng/mL IL-4 were used to induce EMT by incubating BECs for 48 h.

  • IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Nephrol Dial Transplant. 2024 Jul 31;39(8):1344-1359. [Abstract]

    Representative images of polarization models of M1 macrophage and M2 macrophage by flow cytometry in vitro. The RAW264.7 cells were treated with LPS (100 ng/ml) and INF-r (10 ng/ml) for 24 hours to induce M1 macrophage polarization, while IL-4 (20 ng/ml) for 24 hours to induce M2 macrophage polarization.

  • IL-4 Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: BMC Cancer. 2023 Oct 30;23(1):1042. [Abstract]

    M1 macrophages had increased adropin production as stimulated by LPS/IFN-γ, but M2 macrophages had decreased adropin production after being treated by IL-4 (50 ng/mL), IL-10 (50 ng/mL), or TGF-β1