IL-4 Protein, Mouse (HEK293, His)

IL-4 Protein, Mouse (HEK293, His) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression.IL-4 Protein, Mouse (HEK293, His) is a recombinant mouse interleukin-4 (rhIL-4) expressed in HEK 293 cells with a His tag.

IL-4 is a T cell-derived growth factor for B cells. In addition to T cells, IL-4 is produced by innate lymphocytes, such as NTK cells, and myeloid cells, such as basophils and mast cells. It is a signature cytokine of type 2 immune response but also has a nonimmune function. Its expression is tightly regulated at several levels, including signaling pathways, transcription factors, epigenetic modifications, microRNA, and long noncoding RNA. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4⁺ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy^[1].

1.Measured in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells. The ED₅₀ for this effect is <80 pg/mL.
2.Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is ≤1.437 ng/mL, corresponding to a specific activity is ≥6.96×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is 1.437 ng/mL, corresponding to a specific activity is 6.96×10⁵ units/mg.

Mouse

HEK293

C-6*His

P07750 (H21-S140)

16189  [NCBI]

Full Length of Mature Protein

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. I-Cheng Ho,et al. Regulation of IL-4 Expression in Immunity and Diseases. Adv Exp Med Biol. 2016;941:31-77.  [Content Brief]