1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. TGF-β
  5. TGF-β1
  6. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)

TGF beta 1/TGFB1 Protein belongs to the TGF-β superfamily. TGF beta 1/TGFB1 Protein plays a key role in various physiological and pathological processes such as cell growth, differentiation, apoptosis, immune regulation, and extracellular matrix formation. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) is a recombinant TGF beta 1/TGFB1 Protein expressed by HEK293 without a tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
10 μg En stock
50 μg En stock
100 μg Obtenir un devis
> 100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MCE. Usage Cited in: J Clin Invest. 2025 Jun 2;135(11):e184158.  [Abstract]

    Western blot analysis of the indicated protein levels in NIH3T3 cell with TGFβ (5 ng/mL) stimulation for 72 h.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MCE. Usage Cited in: J Clin Invest. 2025 Jun 2;135(11):e184158.  [Abstract]

    Real-time qPCR analysis of Postn, Acta2, Col1a1, Col3a1 and Fn1 mRNA expression levels in NIH3T3 cell with TGFβ (5 ng/mL) stimulation for 72 h.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MCE. Usage Cited in: Adv Healthc Mater. 2023 Apr;12(11):e2203076.  [Abstract]

    The proportions of MMT cells were significantly elevated by TGF-β1 (10 ng/mL, 48 h).

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MCE. Usage Cited in: Adv Healthc Mater. 2023 Apr;12(11):e2203076.  [Abstract]

    Representative immunofluorescence images of α-SMA, the protein expression levels of α-SMA were upregulated by TGF-β1 (10 ng/mL, 48 h).
    • Activité biologique

    • Paramètres Techniques

    • Propriétés

    • Description

    • Références

    Description

    TGF beta 1/TGFB1 Protein belongs to the TGF-β superfamily. TGF beta 1/TGFB1 Protein plays a key role in various physiological and pathological processes such as cell growth, differentiation, apoptosis, immune regulation, and extracellular matrix formation. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) is a recombinant TGF beta 1/TGFB1 Protein expressed by HEK293 without a tag[1][2][3].

    Background

    TGF beta 1/TGFB1 is a multifunctional cytokine. In immune regulation, TGF beta 1/TGFB1 can inhibit the activation of T/B cells, induce the differentiation of regulatory T cells, and promote the polarization of macrophages toward an anti-inflammatory phenotype. TGF beta 1/TGFB1 can also affect the homeostasis of the extracellular matrix by regulating the synthesis and degradation of collagen. When it is overactivated, it will lead to fibrosis of organs such as the liver and lungs. In addition, TGF beta 1/TGFB1 is also involved in the occurrence and development of tumors. In the early stage, it inhibits the proliferation of epithelial cells, induces cell apoptosis, and plays an anti-cancer role. In the late stage, it promotes tumor progression by promoting epithelial-mesenchymal transformation, tumor angiogenesis, and immune escape[1][2][3].

    In Vitro

    TGF beta 1/TGFB1 Protein (Mouse/Rat; 10 ng/mL; 48 h) can be used to establish a fibrotic cell model. It activates SMAD2/3 phosphorylation, upregulates the levels of fibrotic proteins (α-SMA and Col1a1), and inhibits the levels of Acan and Col2a1 in rat nucleus pulposus cells[4].

    Activité biologique

    The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 5-25 pg/mL.

    • The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 23.18 pg/mL, corresponding to a specific activity is 4.31×107 units/mg.
    Species

    Rat; Mouse

    Source

    HEK293

    Tag

    Tag Free

    Accession

    P04202/P17246 (A279-S390)

    Gene ID

    21803  [NCBI]/59086

    Molecular Construction
    N-term
    TGFB1 (A279-S390)
    Accession # P04202
    C-term
    Protein Length

    Full Length of Mature TGFB1

    Synonyms
    TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP; latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1; TGF-β1; TGF beta1; TGFbeta 1; TGF-beta 1; TGFbeta
    AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

    Predicted Molecular Mass
    12.8 kDa
    Masse moléculaire

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

    Structure/Form
    Disulfide-linked homodimer
    Pureté
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
    2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 4%Mannitol.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Livraison

    Room temperature in continental US; may vary elsewhere.

    Documentation
    Références
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Vos produits récemment consultés:

    Demande en ligne

    Your information is safe with us. * Required Fields.

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)

     

    Requested Quantity *

    Nom du demandeur *

     

    Civilité

    Adresse e-mail *

     

    Numéro de téléphone *

    Department

     

    Nom de l'organisation *

    City

    État

    Country or Region *

         

    Remarques

    Bulk Inquiry

    Inquiry Information

    Nom du produit:
    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
    Cat. No.:
    HY-P70648
    Quantité:
    MCE Japan Authorized Agent: