Copy Link Print Information

TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)

32 Cited Publications
Customer Review

Based on 32 publication(s) in Google Scholar

TGF beta 1/TGFB1 Protein belongs to the TGF-β superfamily. TGF beta 1/TGFB1 Protein plays a key role in various physiological and pathological processes such as cell growth, differentiation, apoptosis, immune regulation, and extracellular matrix formation. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) is a recombinant TGF beta 1/TGFB1 Protein expressed by HEK293 without a tag.

For research use only. We do not sell to patients.
  • Species: Rat; Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TGF beta 1/TGFB1 Protein belongs to the TGF-β superfamily. TGF beta 1/TGFB1 Protein plays a key role in various physiological and pathological processes such as cell growth, differentiation, apoptosis, immune regulation, and extracellular matrix formation. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) is a recombinant TGF beta 1/TGFB1 Protein expressed by HEK293 without a tag[1][2][3].

Background

TGF beta 1/TGFB1 is a multifunctional cytokine. In immune regulation, TGF beta 1/TGFB1 can inhibit the activation of T/B cells, induce the differentiation of regulatory T cells, and promote the polarization of macrophages toward an anti-inflammatory phenotype. TGF beta 1/TGFB1 can also affect the homeostasis of the extracellular matrix by regulating the synthesis and degradation of collagen. When it is overactivated, it will lead to fibrosis of organs such as the liver and lungs. In addition, TGF beta 1/TGFB1 is also involved in the occurrence and development of tumors. In the early stage, it inhibits the proliferation of epithelial cells, induces cell apoptosis, and plays an anti-cancer role. In the late stage, it promotes tumor progression by promoting epithelial-mesenchymal transformation, tumor angiogenesis, and immune escape[1][2][3].

In Vitro

TGF beta 1/TGFB1 Protein (Mouse/Rat; 10 ng/mL; 48 h) can be used to establish a fibrotic cell model. It activates SMAD2/3 phosphorylation, upregulates the levels of fibrotic proteins (α-SMA and Col1a1), and inhibits the levels of Acan and Col2a1 in rat nucleus pulposus cells[4].

Verified Bioactivity

The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 5-25 pg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 23.18 pg/mL, corresponding to a specific activity is 4.31×107 units/mg.

Technical Parameters

  • Species Rat; Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    P04202/P17246 (A279-S390)

  • Gene ID
    21803  [NCBI]/59086
  • Molecular Construction
    • N-term
    • TGFB1 (A279-S390)
      Accession # P04202
    • C-term
  • Protein Length

    Full Length of TGFB1 Chain

  • Synonyms

    TGFB1; Transforming Growth Factor Beta1; Prev. TGFB; Camurati-Engelmann Disease; Prev. DPD1; Latency-Associated Peptide; TGFbeta; TGF-Beta-1; CED; TGF-Beta1; Transforming Growth Factor Beta-1 Proprotein; IBDIMDE; Prepro-Transforming Growth Factor Beta-1;

  • AA Sequence

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

  • Predicted Molecular Mass

    12.8 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl.
2.Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 4%Mannitol.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Kim KK, et al. TGF-β1 Signaling and Tissue Fibrosis. Cold Spring Harb Perspect Biol. 2018 Apr 2;10(4):a022293. [Content Brief]

[2]. Laudisi F, et al. TGF-β1 signaling and Smad7 control T-cell responses in health and immune-mediated disorders. Eur J Immunol. 2023 Nov;53(11):e2350460. [Content Brief]

[3]. Lodyga M, et al. TGF-β1 - A truly transforming growth factor in fibrosis and immunity. Semin Cell Dev Biol. 2020 May;101:123-139. [Content Brief]

[4]. Lu R, et al. Physalin A alleviates intervertebral disc degeneration via anti-inflammatory and anti-fibrotic effects. J Orthop Translat. 2023 Jan 25;39:74-87. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 23.18 pg/mL, corresponding to a specific activity is 4.31×107 units/mg.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MedChemExpress. Usage Cited in: J Clin Invest. 2025 Jun 2;135(11):e184158. [Abstract]

    Customer Validation
     Western blot analysis of the indicated protein levels in NIH3T3 cell with TGFβ (5 ng/mL) stimulation for 72 h.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MedChemExpress. Usage Cited in: J Clin Invest. 2025 Jun 2;135(11):e184158. [Abstract]

    Customer Validation
     Real-time qPCR analysis of Postn, Acta2, Col1a1, Col3a1 and Fn1 mRNA expression levels in NIH3T3 cell with TGFβ (5 ng/mL) stimulation for 72 h.

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MedChemExpress. Usage Cited in: Adv Healthc Mater. 2023 Apr;12(11):e2203076. [Abstract]

    Customer Validation
     The proportions of MMT cells were significantly elevated by TGF-β1 (10 ng/mL, 48 h).

  • 1/16

    TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) purchased from MedChemExpress. Usage Cited in: Adv Healthc Mater. 2023 Apr;12(11):e2203076. [Abstract]

    Customer Validation
     Representative immunofluorescence images of α-SMA, the protein expression levels of α-SMA were upregulated by TGF-β1 (10 ng/mL, 48 h).

  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) Product Image
    1/16
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • Experimental Validation Results for TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
  • TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) Product Image