IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293)

IL-23 alpha, a crucial component, combines with IL12B to create the IL-23 interleukin, a heterodimeric cytokine pivotal in innate and adaptive immunity. Operating in peripheral tissues, IL-23, along with IL-17, responds acutely to infections. It binds to IL12RB1 and IL23R, activating Jak-Stat signaling, preferentially stimulating memory T-cells, and inducing pro-inflammatory cytokines. Released by antigen-presenting cells, IL-23 plays a role in autoimmune inflammation, contributing to autoimmune diseases and tumorigenesis, and supports the expansion of T-helper 17 cells. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293, with tag free. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293), has molecular weight of 18-27 kDa & 40-55 kDa, respectively.

IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.

Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells.The ED₅₀ for this effect is ≤ 20.75 ng/mL, corresponding to a specific activity is ≥4.82×10⁴ U/mg.

• 
  Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells.The ED₅₀ for this effect is 20.75ng/mL, corresponding to a specific activity is 4.82×10⁴ U/mg.

Mouse

HEK293

Tag Free

Q9EQ14 (V22-A196)&P43432 (M23-S335)

83430  [NCBI]&16160  [NCBI]

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

18-27kDa&40-55 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.