IL-23 Protein, Mouse (HEK293)
Based on 1 Customer Validation
IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
-
HY-P7073
IL-1 beta Protein, Mouse
-
HY-P7063
IL-6 Protein, Mouse
-
HY-P7117
TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293, Tag Free)
-
HY-P990121
Anti-Mouse IL-4 Antibody (11B11)
-
HY-P70648
TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)
-
HY-P7077
IL-2 Protein, Mouse
-
HY-P990798
Anti-Mouse IFN gamma Antibody (XMG1.2)
-
HY-P70666
IL-12 Protein, Mouse (HEK293)
-
HY-P7109
EGF Protein, Human
-
HY-P70753
IL-17A Protein, Mouse (HEK293, His)
-
HY-P7208
IL-12 Protein, Mouse (CHO)
-
HY-P73226
IL-7 Protein, Mouse
Biological Activity
IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with tag free.
IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.
1.Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells.The ED50 for this effect is <25 ng/mL.
2.Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED50 for this effect is 637.10 ng/mL.
3.Measured by its binding ability in a functional ELISA. Immobilized Human IL-23R at 10 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-23 Protein. The ED50 for this effect is 0.1-1.0 μg/mL.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Molecular Construction
-
N-term
-
IL23A (V22-A196)
Accession # Q9EQ14 -
C-term
-
N-term
-
IL12B (M23-S335)
Accession # P43432 -
C-term
-
-
Synonyms
IL23A; Interleukin 23, Alpha Subunit P19; Interleukin 23 Subunit Alpha; Interleukin-23 Subunit Alpha; SGRF; Interleukin-23 Subunit P19; IL23P19; IL-23 Subunit Alpha; IL-23A; IL-23p19; IL-23; IL-23-A; P19; JKA3 Induced Upon T-Cell Activation; Interleukin-S
-
AA Sequence
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
-
Predicted Molecular Mass
19.7 kDa (p19) & 35.8 kDa (p40)
-
Molecular Weight
Approximately 18 kDa & 40-55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
