IL-23 Protein, Human (HEK293, His)

IL-23, collaborating with IL12B, constitutes the pro-inflammatory cytokine IL-23, crucial in innate and adaptive immunity. Released by antigen-presenting cells like dendritic cells or macrophages, IL-23 binds to IL12RB1 and IL23R, activating JAK2 and TYK2. This cascade phosphorylates STAT3 and STAT4, activating pathways like p38 MAPK or NF-kappa-B, inducing pro-inflammatory cytokines. IL-23 contributes to intracellular bacterial clearance and supports the expansion of T-helper 17 cells, including IL-17 producers. The disulfide-linked IL-23 interacts with IL12B and IL23R, recruiting IL12RB1. IL-23 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived IL-23 protein, expressed by HEK293, with C-6*His labeled tag. IL-23 Protein, Human (HEK293, His), has molecular weight of approximately 63.08 kDa.

IL-23, in collaboration with IL12B, forms the pro-inflammatory cytokine IL-23, playing diverse roles in both innate and adaptive immunity. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to a heterodimeric receptor complex comprising IL12RB1 and IL23R, initiating a cascade involving JAK2 and TYK2 activation. These kinases phosphorylate the receptor, creating a docking site for the subsequent phosphorylation of STAT3 and STAT4. This process activates multiple pathways, including p38 MAPK or NF-kappa-B, fostering the production of pro-inflammatory cytokines, such as interleukin-17A/IL17A. Additionally, IL-23 actively participates in the early and effective clearance of intracellular bacteria. Notably, IL-23 promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, alongside other IL-17-producing cells. The heterodimeric association of IL-23 with IL12B, known as interleukin IL-23, is disulfide-linked. Furthermore, IL-23 interacts with IL23R, facilitating the recruitment of IL12RB1.

1. Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED₅₀ for this effect is 300-900 ng/mL.
2. Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED₅₀ for this effect is 2.324 ng/mL, corresponding to a specific activity is 4.3×10^5 U/mg.

• 
  Measured by its ability to induce IL17 secretion by mouse CTLL-2 cells. The ED₅₀ for this effect is 2.324 ng/mL, corresponding to a specific activity is 4.3×10⁵ U/mg.

Human

HEK293

C-6*His

Q9NPF7 (R20-P189)&P29460 (I23-S328)

51561  [NCBI]&3593  [NCBI]

IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

approximately 63.08 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.