IL-23 Protein, Marmoset (HEK293, His)

IL-23 alpha protein, a member of the IL-6 superfamily, is featured. IL-23 Protein, Marmoset (HEK293, His) is a recombinant protein dimer complex containing Marmoset-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293 , with C-His labeled tag. IL-23 Protein, Marmoset (HEK293, His), has molecular weight of ~22 & 45 kDa, respectively.

For research use only. We do not sell to patients.
  • Species: Marmoset
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-23 alpha protein, a member of the IL-6 superfamily, is featured. IL-23 Protein, Marmoset (HEK293, His) is a recombinant protein dimer complex containing Marmoset-derived IL-23 alpha & IL-12 beta Heterodimer protein, expressed by HEK293 , with C-His labeled tag. IL-23 Protein, Marmoset (HEK293, His), has molecular weight of ~22 & 45 kDa, respectively.

Background

IL-23 alpha Protein belongs to the IL-6 superfamily.

Technical Parameters

  • Species Marmoset
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL23A (R20-P189)
      Accession # A0A2R8N533
    • 10*His
    • C-term
    • N-term
    • IL12B (I23-N328)
      Accession # XP_035133514.2
    • 10*His
    • C-term
  • Synonyms

    IL23A; Interleukin 23, Alpha Subunit P19; Interleukin 23 Subunit Alpha; Interleukin-23 Subunit Alpha; SGRF; Interleukin-23 Subunit P19; IL23P19; IL-23 Subunit Alpha; IL-23A; IL-23p19; IL-23; IL-23-A; P19; JKA3 Induced Upon T-Cell Activation; Interleukin-S

  • AA Sequence

    IL23A:
    RAVPGGSSPAWTQCQQLSQKLCMLAWSAHPLVGHMHLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSPGPSQPWQRLLLRFKILRSLQAFVAVAARV
    FAHGAATLSP IL12B:
    IWELKKDVYVIELDWYLDAPGEMVVITCDTPEEDGITWTLEESSEVLGSGKNLTIQVKEFGDAGQYTCHKGGEALSHLLLLLHKKEDGVWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPRGVMCGAPVLSAERVRADGKEYEYSVECQEDSACPAAEERLPIEVVVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRVFMDKTSATVICRKNASVSVQAQDRYYSSSWSEWASVPCN

  • Predicted Molecular Mass

    56.4 kDa

  • Molecular Weight

    Approximately 22 kDa (marmoset IL23A) & 45 kDa (marmoset IL12B), based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00