Copy Link Print Information

IL-23 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. IL-23 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived IL-23 alpha & IL-12 beta, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
  • IL-23 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-23 and IL12B together constitute the pro-inflammatory cytokine IL-23, which is crucial in innate and adaptive immunity. IL-23 is released by antigen-presenting cells such as dendritic cells or macrophages, binds to IL12RB1 and IL23R, and activates JAK2 and TYK2. IL-23 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived IL-23 alpha & IL-12 beta, expressed by HEK293 , with C-His labeled tag.

Background

IL-23, in collaboration with IL12B, forms the pro-inflammatory cytokine IL-23, playing diverse roles in both innate and adaptive immunity. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to a heterodimeric receptor complex comprising IL12RB1 and IL23R, initiating a cascade involving JAK2 and TYK2 activation. These kinases phosphorylate the receptor, creating a docking site for the subsequent phosphorylation of STAT3 and STAT4. This process activates multiple pathways, including p38 MAPK or NF-kappa-B, fostering the production of pro-inflammatory cytokines, such as interleukin-17A/IL17A. Additionally, IL-23 actively participates in the early and effective clearance of intracellular bacteria. Notably, IL-23 promotes the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, alongside other IL-17-producing cells. The heterodimeric association of IL-23 with IL12B, known as interleukin IL-23, is disulfide-linked. Furthermore, IL-23 interacts with IL23R, facilitating the recruitment of IL12RB1.

Verified Bioactivity

1.Measured by its ability to induce IL-17 secretion by CTLL-2 cells. The ED50 for this effect is 14.92 ng/mL, corresponding to a specific activity is 6.7×104 U/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized Human IL23R (HY-P70680) at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 120-300 ng/mL.
3.Measured by its ability to induce STAT reporter activity in 293F human embryonic kidney cells. The ED50 for this effect is 70-210 ng/mL.

Results

  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
    Measured by its binding ability in a functional ELISA. Immobilized IL-23R at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 257.4 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized IL-23R at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 257.4 ng/mL.

  • Biological Activity

    Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized IL-23R at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 257.4 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q9NPF7/NP_057668.1 (R20-P189)&P29460/NP_002178.2 (I23-S328)

  • Gene ID
    51561  [NCBI]&3593  [NCBI]
  • Synonyms

    IL23A; Interleukin 23, Alpha Subunit P19; Interleukin 23 Subunit Alpha; Interleukin-23 Subunit Alpha; SGRF; Interleukin-23 Subunit P19; IL23P19; IL-23 Subunit Alpha; IL-23A; IL-23p19; IL-23; IL-23-A; P19; JKA3 Induced Upon T-Cell Activation; Interleukin-S

  • AA Sequence

    IL-23alpha:
    RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
    IL-12beta:
    IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

  • Predicted Molecular Mass

    20 kDa & 36 kDa

  • Molecular Weight

    Approximately 19-22 kDa & 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 200 mM trehalose, 4% mannitol, 50 mM NaCl, 0.02% Tween 80, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized IL-23R at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 257.4 ng/mL.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized IL-23R at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 257.4 ng/mL.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized IL-23R at 2 μg/mL (100 μL/well) can bind Human IL-23 alpha & IL-12 beta Heterodimer Protein. The ED50 for this effect is 257.4 ng/mL.

  • IL-23 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
  • Experimental Validation Results for IL-23 Protein, Human (HEK293, His)
  • IL-23 Protein, Human (HEK293, His) Product Image