Copy Link Print Information

M-CSF Protein, Mouse

145 Cited Publications
Customer Review

Based on 145 publication(s) in Google Scholar

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse is the recombinant mouse-derived M-CSF protein, expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • M-CSF Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse is the recombinant mouse-derived M-CSF protein, expressed by E. coli.

Background

Macrophage Colony Stimulating Factor (M-CSF) is a pro-inflammatory cytokine, constitutively produced by several cell types, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, binds to its receptor CSF1R, and exists in several isoforms- as a secreted glycoprotein, a cell-surface protein and a proteoglycan[1]. M-CSF is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts, which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes seen in patients with rheumatoid arthritis[2].

In Vitro

M-CSF Protein, Mouse (25 ng/mL, 5 days) can be added into cell medium for differentiation of bone marrow-derived macrophages (BMDMs)[3].

Verified Bioactivity

The ED50 is <3 ng/mL as measured by murine M-NFS-60 cells, corresponding to a specific activity of >3.3 × 105 units/mg.

Results
  • Experimental Validation Results for M-CSF Protein, Mouse
    Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.297 ng/mL, corresponding to a specific activity is 7.71×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P07141-1 (K33-P187)

  • Gene ID
    12977  [NCBI]
  • Molecular Construction
    • N-term
    • M-CSF (K33-P187)
      Accession # P07141-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rMuM-CSF; CSF-1; MGI-IM

  • AA Sequence

    KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

  • Predicted Molecular Mass

    18 kDa

  • Molecular Weight

    Approximately 17-20 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for M-CSF Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8(7):533-44. [Content Brief]

[2]. Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58(8):2257-67. [Content Brief]

[3]. Mu W, et al., Carnosic Acid Directly Targets STING C-Terminal Tail to Improve STING-Mediated Inflammatory Diseases. Adv Sci (Weinh). 2025 Apr;12(14):e2417686. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.297 ng/mL, corresponding to a specific activity is 7.71×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.297 ng/mL, corresponding to a specific activity is 7.71×105 units/mg.

  • 1/16

    M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2025 Aug 28.

    Customer Validation
     BMDMs were obtained from 6-8 weeks old BALB/c mice. After seven days of in vitro stimulation with macrophage colony-stimulating factor (M-CSF) (20 ng/mL), the cells exhibited a mature macrophage phenotype, with 87.5% of the population being F4/80⁺CD11b⁺, as confirmed by flow cytometry.

  • 1/16

    M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Nat Commun. 2025 Feb 24;16(1):1909. [Abstract]

    Customer Validation
     Levels of pro-inflammatory cytokines in the culture supernatants of BMDMs from wild-type C57BL/6 J mice and IRF7−/− mice after LPS (500 ng/mL) stimulation for 4 h. BMDMs were isolated from male C57BL/6 J mice and IRF7−/− mice. The isolated bone marrow cells were resuspended in BMDM culture medium (DMEM supplemented with 10% fetal bovine serum, 1% penicillin-streptomycin, and 50  ng/mL M-CSF).

  • 1/16

    M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Apr;12(14):e2417686. [Abstract]

    Customer Validation
     BMDMs were cultured in DMEM containing FBS (10%), penicillin/streptomycin (1%), and M‐CSF (25 ng/mL) for 5 days. Cell viability of BMDMs and THP-1 cells were detected after being administrated with the indicated concentrations of Carnosic acid for 12 h.

  • 1/16

    M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2024 May 23.

    Customer Validation
     RAW264.7 cells were cocultured with 30 ng/mL M-CSF (MedChemExpress, USA). Containing 75 ng/mL Rankl (MedChemExpress, USA) were added at 2 days with 30 ng/mL M-CSF. After the appearance of multinucleated giant cells, cells were washed with PBS and fixed with 4% paraformaldehyde. After incubation with TRAP staining solution for 30 min and washed with double steaming, the nuclei were stained with hematoxylin for 2-3 min.

  • 1/16

    M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2024 May 23.

    Customer Validation
     RAW264.7 cells were cocultured with 30 ng/mL M-CSF (MedChemExpress, USA). Containing 75 ng/mL Rankl (MedChemExpress, USA) were added at 2 days with 30 ng/mL M-CSF. The expression of CK and MMP9 genes after different treatment.

  • M-CSF Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • Experimental Validation Results for M-CSF Protein, Mouse
  • M-CSF Protein, Mouse Product Image

  • M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2025 Aug 28.

    BMDMs were obtained from 6-8 weeks old BALB/c mice. After seven days of in vitro stimulation with macrophage colony-stimulating factor (M-CSF) (20 ng/mL), the cells exhibited a mature macrophage phenotype, with 87.5% of the population being F4/80⁺CD11b⁺, as confirmed by flow cytometry.

  • M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Nat Commun. 2025 Feb 24;16(1):1909. [Abstract]

    Levels of pro-inflammatory cytokines in the culture supernatants of BMDMs from wild-type C57BL/6 J mice and IRF7−/− mice after LPS (500 ng/mL) stimulation for 4 h. BMDMs were isolated from male C57BL/6 J mice and IRF7−/− mice. The isolated bone marrow cells were resuspended in BMDM culture medium (DMEM supplemented with 10% fetal bovine serum, 1% penicillin-streptomycin, and 50  ng/mL M-CSF).

  • M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Sci (Weinh). 2025 Apr;12(14):e2417686. [Abstract]

    BMDMs were cultured in DMEM containing FBS (10%), penicillin/streptomycin (1%), and M‐CSF (25 ng/mL) for 5 days. Cell viability of BMDMs and THP-1 cells were detected after being administrated with the indicated concentrations of Carnosic acid for 12 h.

  • M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2024 May 23.

    RAW264.7 cells were cocultured with 30 ng/mL M-CSF (MedChemExpress, USA). Containing 75 ng/mL Rankl (MedChemExpress, USA) were added at 2 days with 30 ng/mL M-CSF. After the appearance of multinucleated giant cells, cells were washed with PBS and fixed with 4% paraformaldehyde. After incubation with TRAP staining solution for 30 min and washed with double steaming, the nuclei were stained with hematoxylin for 2-3 min.

  • M-CSF Protein, Mouse purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2024 May 23.

    RAW264.7 cells were cocultured with 30 ng/mL M-CSF (MedChemExpress, USA). Containing 75 ng/mL Rankl (MedChemExpress, USA) were added at 2 days with 30 ng/mL M-CSF. The expression of CK and MMP9 genes after different treatment.