1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Mouse

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse is the recombinant mouse-derived M-CSF protein, expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

129 Publications Citing Use of MCE M-CSF Protein, Mouse

Flow Cytometry
Cell Proliferation/Viability Assay
Histological Imaging/Staining
RT-PCR

    M-CSF Protein, Mouse purchased from MCE. Usage Cited in: Adv Funct Mater. 2025 Aug 28.

    BMDMs were obtained from 6-8 weeks old BALB/c mice. After seven days of in vitro stimulation with macrophage colony-stimulating factor (M-CSF) (20 ng/mL), the cells exhibited a mature macrophage phenotype, with 87.5% of the population being F4/80⁺CD11b⁺, as confirmed by flow cytometry.

    M-CSF Protein, Mouse purchased from MCE. Usage Cited in: Nat Commun. 2025 Feb 24;16(1):1909.  [Abstract]

    Levels of pro-inflammatory cytokines in the culture supernatants of BMDMs from wild-type C57BL/6 J mice and IRF7−/− mice after LPS (500 ng/mL) stimulation for 4 h. BMDMs were isolated from male C57BL/6 J mice and IRF7−/− mice. The isolated bone marrow cells were resuspended in BMDM culture medium (DMEM supplemented with 10% fetal bovine serum, 1% penicillin-streptomycin, and 50  ng/mL M-CSF).

    M-CSF Protein, Mouse purchased from MCE. Usage Cited in: Adv Sci (Weinh). 2025 Apr;12(14):e2417686.  [Abstract]

    BMDMs were cultured in DMEM containing FBS (10%), penicillin/streptomycin (1%), and M‐CSF (25 ng/mL) for 5 days. Cell viability of BMDMs and THP-1 cells were detected after being administrated with the indicated concentrations of Carnosic acid for 12 h.

    M-CSF Protein, Mouse purchased from MCE. Usage Cited in: Adv Funct Mater. 2024 May 23.

    RAW264.7 cells were cocultured with 30 ng/mL M-CSF (MedChemExpress, USA). Containing 75 ng/mL Rankl (MedChemExpress, USA) were added at 2 days with 30 ng/mL M-CSF. After the appearance of multinucleated giant cells, cells were washed with PBS and fixed with 4% paraformaldehyde. After incubation with TRAP staining solution for 30 min and washed with double steaming, the nuclei were stained with hematoxylin for 2-3 min.

    M-CSF Protein, Mouse purchased from MCE. Usage Cited in: Adv Funct Mater. 2024 May 23.

    RAW264.7 cells were cocultured with 30 ng/mL M-CSF (MedChemExpress, USA). Containing 75 ng/mL Rankl (MedChemExpress, USA) were added at 2 days with 30 ng/mL M-CSF. The expression of CK and MMP9 genes after different treatment.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse is the recombinant mouse-derived M-CSF protein, expressed by E. coli.

    Background

    Macrophage Colony Stimulating Factor (M-CSF) is a pro-inflammatory cytokine, constitutively produced by several cell types, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, binds to its receptor CSF1R, and exists in several isoforms- as a secreted glycoprotein, a cell-surface protein and a proteoglycan[1]. M-CSF is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts, which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes seen in patients with rheumatoid arthritis[2].

    In Vitro

    M-CSF Protein, Mouse (25 ng/mL, 5 days) can be added into cell medium for differentiation of bone marrow-derived macrophages (BMDMs)[3].

    Biological Activity

    The ED50 is <3 ng/mL as measured by murine M-NFS-60 cells, corresponding to a specific activity of >3.3 × 105 units/mg.

    • Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.297 ng/mL, corresponding to a specific activity is 7.71×105 units/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P07141-1 (K33-P187)

    Gene ID
    Molecular Construction
    N-term
    M-CSF (K33-P187)
    Accession # P07141-1
    C-term
    Protein Length

    Partial

    Synonyms
    rMuM-CSF; CSF-1; MGI-IM
    AA Sequence

    KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

    Predicted Molecular Mass
    18 kDa
    Molecular Weight

    Approximately 17-20 kDa, based on SDS-PAGE under non reducing (N) conditions.

    Structure/Form
    Disulfide-linked homodimer
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0.
    3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    M-CSF Protein, Mouse Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    M-CSF Protein, Mouse

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    M-CSF Protein, Mouse
    Cat. No.:
    HY-P7085
    Quantity:
    MCE Japan Authorized Agent: