M-CSF Protein, Rat (HEK293)
Based on 1 Customer Validation
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.
M-CSF Protein assumes a crucial role in orchestrating the regulation of survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. Its significance extends to promoting the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Moreover, M-CSF is a key player in the regulation of osteoclast proliferation and differentiation, influencing bone resorption and contributing to normal bone development. Beyond its impact on the skeletal system, M-CSF is indispensable for normal male and female fertility. The cytokine also plays a role in lipoprotein clearance and contributes to cellular processes such as reorganizing the actin cytoskeleton, regulating the formation of membrane ruffles, cell adhesion, and cell migration. M-CSF can exist in various forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. It interacts with its receptor CSF1R to exert its diverse functions.
Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.02302 ng/mL, corresponding to a specific activity is 4.34×107 units/mg.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag Tag Free
-
Accession
Q8JZQ0-1 (E33-R254)
-
Molecular Construction
-
N-term
-
M-CSF (E33-R254)
Accession # Q8JZQ0-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo
-
AA Sequence
EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR
-
Predicted Molecular Mass
25.2 kDa
-
Molecular Weight
Approximately 46 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)