IL-13 Protein, Rat
Based on 1 publication(s) in Google Scholar
IL-13 Protein, Rat is a cytokine secreted by many cell types, but especially T helper type 2 (Th2) cells, that is an important mediator of allergic inflammation and disease.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-13 Protein, Rat is a cytokine secreted by many cell types, but especially T helper type 2 (Th2) cells, that is an important mediator of allergic inflammation and disease.
Background
Interleukin (IL)-13 plays a pivotal role in the pathogenesis of allergic asthma. Passive administration of its monoclonal antibody or soluble receptor to block overproduced IL-13 has been proven to be effective in controlling airway allergic responses in animal models, but these approaches have disadvantages of short half-lives, high costs, and possible adverse effects. IL-13 induces the gene expression of Ca2+-activating chloride channel, stimulates the differentiation of epithelial cells, and promotes mucin gene expression and release. IL-13 plays a key role in the pathogenesis of asthma[1].
Verified Bioactivity
The ED50 was determined by the dose-dependent proliferation of TF-1 cells is ≤ 5.0 ng/mL, corresponding to a specific activity of ≥ 2x105 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Mol Cell Biochem
HIRA promotes osteogenic differentiation of BMSCs and ameliorates osteoporosis by mediating M2 polarization of macrophages through the YAP1/β-catenin pathway. [Abstract]2026 Jun;481(6):2449-2466. PMID: 42048035
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
P42203 (T19-H131)
-
Molecular Construction
-
N-term
-
IL-13 (T19-H131)
Accession # P42203 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
TPGPVRRSTSPPVALRELIEELSNITQDQKTSLCNSSMVWSVDLTAGGFCAALESLTNISSCNAIHRTQRILNGLCNQKASDVASSPPDTKIEVAQFISKLLNYSKQLFRYGH
-
Predicted Molecular Mass
12.3 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 98%, as determined by reducing SDS-PAGE.;≥ 98%, as determined by HPLC.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)