Copy Link Print Information

RANKL/TNFSF11 Protein, Mouse

18 Cited Publications
Customer Review

Based on 18 publication(s) in Google Scholar

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Mouse is a recombinant mouse RANKL (Q137-D316) without tag, which is produced in E.coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • RANKL/TNFSF11 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Mouse is a recombinant mouse RANKL (Q137-D316) without tag, which is produced in E.coli[1][2].

Background

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. RANKL binds to RANK and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells[2]. In mice, RANKL/RANK signaling attenuates inflammation in ischemic brains through a Toll-like receptor signaling pathway[4].
RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)[1].

In Vitro

RANKL (mouse, 3 ng/mL, 4 days) induces osteoclast differentiation from RAW264.7 cells, and can be inhibited by Resveratrol[5].
RANKL (mouse,10 ng/mL, 0-3 h) induces NF-κB activation in murine hepatocyte cell line (AML-12) [6].

In Vivo

RANKL (mouse, i.c.v., 5 ng in 2 μL) reduces IL-1β, MCP-1, IL-6 and TNFα expression in WT mice[4].
RANKL (mouse, i.p., 1-10 μg) protects against hepatic ischemia/reperfusion liver injury in mice[6].

Verified Bioactivity

1.Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 is ≤1.192 ng/mL as measured by RAW 264.7 mouse monocyte/macrophage cells, corresponding to a specific activity of ≥8.39 × 105 units/mg.
2. Measured by its binding ability in a functional ELISA. Immobilized mouse TNFSF11 at 10 μg/mL (100μL/well) can bind biotinylated Human TNFRSF11B. The ED50 for this effect is 0.0848 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 is <1.808 ng/mL as measured by RAW 264.7 mouse monocyte/macrophage cells, corresponding to a specific activity of >5.531 × 105 units/mg.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized mouse TNFSF11 at 10 μg/mL (100 μL/well) can bind biotinylated Human TNFRSF11B. The ED50 for this effect is 0.0848 μg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    O35235-1 (Q137-D316)

  • Gene ID
    21943  [NCBI]
  • Molecular Construction
    • N-term
    • RANKL/TNFSF11 (Q137-D316)
      Accession # O35235-1
    • C-term
  • Protein Length

    Full Length of Tumor necrosis factor ligand superfamily member 11, soluble form Chain

  • Synonyms

    TNFSF11; Tumor Necrosis Factor (Ligand) Superfamily, Member 11; TNF Superfamily Member 11; Receptor Activator Of Nuclear Factor Kappa-B Ligand; TRANCE; TNLG6B; RANKL; Receptor Activator Of Nuclear Factor Kappa B Ligand; OPGL; Tumor Necrosis Factor Ligand

  • AA Sequence

    QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

  • Predicted Molecular Mass

    20.1 kDa

  • Molecular Weight

    Approximately 20-29 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 1 mM EDTA, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Ono T, et al. RANKL biology: bone metabolism, the immune system, and beyond. Inflamm Regen. 2020 Feb 7;40:2. [Content Brief]

[2]. Hofbauer LC, et al. Role of receptor activator of nuclear factor-kappaB ligand and osteoprotegerin in bone cell biology. J Mol Med (Berl). 2001 Jun;79(5-6):243-53. [Content Brief]

[3]. Li B, et al. Roles of the RANKL-RANK Axis in Immunity-Implications for Pathogenesis and Treatment of Bone Metastasis. Front Immunol. 2022 Mar 21;13:824117. [Content Brief]

[4]. Tobeiha M, et al. RANKL/RANK/OPG Pathway: A Mechanism Involved in Exercise-Induced Bone Remodeling. Biomed Res Int. 2020 Feb 19;2020:6910312. [Content Brief]

[5]. Shimamura M, et al. OPG/RANKL/RANK axis is a critical inflammatory signaling system in ischemic brain in mice. Proc Natl Acad Sci U S A. 2014 Jun 3;111(22):8191-6. [Content Brief]

[6]. He X, et al. Resveratrol prevents RANKL-induced osteoclast differentiation of murine osteoclast progenitor RAW 264.7 cells through inhibition of ROS production. Biochem Biophys Res Commun. 2010 Oct 22;401(3):356-62. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 is <1.808 ng/mL as measured by RAW 264.7 mouse monocyte/macrophage cells, corresponding to a specific activity of >5.531 × 105 units/mg.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized mouse TNFSF11 at 10 μg/mL (100 μL/well) can bind biotinylated Human TNFRSF11B. The ED50 for this effect is 0.0848 μg/mL.

  • 1/16

    RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Bioact Mater. 2025 Nov 29:58:1-18. [Abstract]

    Customer Validation
     Protein expression of PKM2, HK2, LDHA, and β-actin detected by Western blotting after 5-day RANKL (50 ng/mL, HY-P7425) treatment.

  • 1/16

    RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Aug;319(Pt 4):145639. [Abstract]

    Customer Validation
     Western blot analysis showing differential expression of ETS2 during OC-induced differentiation. Western blot analysis showed that after 2 and 4 days of RANKL (50 ng/mL, HY-P7425) and M-CSF (50 ng/mL) induction in BMM cells, the expression of ETS2 increased over time.

  • 1/16

    RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Chin Med. 2025 Jul 2;20(1):100. [Abstract]

    Customer Validation
     BMDMs were pretreated with or without 20 μmol/L ALA for 2 h and treated with 100 ng/mL RANKL (HY-P7425) for 0/5/15 min Ca2+ were stained with calcium indicator Fluo-4/AM and the captured fluorescence images were as shown. Scale bar =10 μm. The results showed that the stimulation with RANKL elicited a pronounced elevation in fluorescence intensity within BMDMs.

  • 1/16

    RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Chin Med. 2025 Jul 2;20(1):100. [Abstract]

    Customer Validation
     The protein level of IκBα, p65, p-p38, p-erk1/2 and p-jnk in BMDMs pretreated with or without 20 μmol/L ALA for 2 h and treated with 100 ng/mL RANKL (HY-P7425) for 0/5/15/30/60/120 min.

  • 1/16

    RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Front Cell Dev Biol. 2025 Sep 9:13:1621648. [Abstract]

    Customer Validation
     BMMs were untreated (Control) or treated with si-NC/si-Tcirg1, seeded onto homemade bovine bone slices placed in Corning 96-well plates, cultured with M-CSF (30 ng/mL) and RANKL (100 ng/mL, HY-P7425) for 7 days, fixed, and processed for SEM; scale bar: 50 μm.

  • RANKL/TNFSF11 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • Experimental Validation Results for RANKL/TNFSF11 Protein, Mouse
  • RANKL/TNFSF11 Protein, Mouse Product Image

  • RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Bioact Mater. 2025 Nov 29:58:1-18. [Abstract]

    Protein expression of PKM2, HK2, LDHA, and β-actin detected by Western blotting after 5-day RANKL (50 ng/mL, HY-P7425) treatment.

  • RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Int J Biol Macromol. 2025 Aug;319(Pt 4):145639. [Abstract]

    Western blot analysis showing differential expression of ETS2 during OC-induced differentiation. Western blot analysis showed that after 2 and 4 days of RANKL (50 ng/mL, HY-P7425) and M-CSF (50 ng/mL) induction in BMM cells, the expression of ETS2 increased over time.

  • RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Chin Med. 2025 Jul 2;20(1):100. [Abstract]

    BMDMs were pretreated with or without 20 μmol/L ALA for 2 h and treated with 100 ng/mL RANKL (HY-P7425) for 0/5/15 min Ca2+ were stained with calcium indicator Fluo-4/AM and the captured fluorescence images were as shown. Scale bar =10 μm. The results showed that the stimulation with RANKL elicited a pronounced elevation in fluorescence intensity within BMDMs.

  • RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Chin Med. 2025 Jul 2;20(1):100. [Abstract]

    The protein level of IκBα, p65, p-p38, p-erk1/2 and p-jnk in BMDMs pretreated with or without 20 μmol/L ALA for 2 h and treated with 100 ng/mL RANKL (HY-P7425) for 0/5/15/30/60/120 min.

  • RANKL/TNFSF11 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Front Cell Dev Biol. 2025 Sep 9:13:1621648. [Abstract]

    BMMs were untreated (Control) or treated with si-NC/si-Tcirg1, seeded onto homemade bovine bone slices placed in Corning 96-well plates, cultured with M-CSF (30 ng/mL) and RANKL (100 ng/mL, HY-P7425) for 7 days, fixed, and processed for SEM; scale bar: 50 μm.