1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. RANK L/TNFSF11 Protein, Mouse

RANK L/TNFSF11 Protein, Mouse

Cat. No.: HY-P7425
Handling Instructions

RANK L/TNFSF11 Protein, Mouse is a TNF-related activation-induced cytokine produced in E. coli. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $320 In-stock
Estimated Time of Arrival: December 31
50 μg $980 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

RANK L/TNFSF11 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O35235 (Q137-D316)

Gene ID

21943

Synonyms
rMuRANK L/TNFSF11; TRANCE; CD254
AA Sequence

QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Weight

Approximately 20.1 kDa

Biological Activity
The ED50 is 0.2-1 ng/mL as measured by RAW 264.7 mouse monocyte/macrophage cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM Tris, 150 mM NaCl, 1 mM EDTA, pH 8.0.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Receptor activator of NF-κB ligand (RANKL), its cellular receptor, receptor activator of NF-κB (RANK), and the decoy receptor osteoprotegerin (OPG) constitute a novel cytokine system. RANKL produced by osteoblastic lineage cells and activated T lymphocytes is the essential factor for osteoclast formation, fusion, activation, and survival, thus resulting in bone resorption and bone loss. RANKL activates its specific receptor, RANK located on osteoclasts and dendritic cells, and its signaling cascade involves stimulation of the c-jun, NF-κB, and serine/threonine kinase PKB/Akt pathways[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANK L/TNFSF11 Protein, Mouse
Cat. No.:
HY-P7425
Quantity:
MCE Japan Authorized Agent: