RANKL/TNFSF11 Protein, Mouse

18 Cited Publications
Customer Review

Based on 18 publication(s) in Google Scholar

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Mouse is a recombinant mouse RANKL (Q137-D316) without tag, which is produced in E.coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs). RANKL/TNFSF11 Protein, Mouse is a recombinant mouse RANKL (Q137-D316) without tag, which is produced in E.coli[1][2].

Background

RANKL (TNFSF11) belongs to TNF family. RANKL is a type II transmembrane protein and is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. RANKL binds to RANK and induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. In bone tissue, RANKL is expressed by osteoblasts, osteocytes and immune cells, especially in osteoblasts and osteocytes[1]. RANKL is also expressed by T cells and increases proliferation and survival of dendritic cells[2]. In mice, RANKL/RANK signaling attenuates inflammation in ischemic brains through a Toll-like receptor signaling pathway[4].
RANKL consists of cytoplasmic domain (1-47), helical domain (48-68), and extracellular domain (69-317). The soluble chain (140-317) is released when cleaved by enzymes such as matrix metalloproteinases (MMP3 or 7) and ADAM[1][3].
RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs)[1].

In Vitro

RANKL (mouse, 3 ng/mL, 4 days) induces osteoclast differentiation from RAW264.7 cells, and can be inhibited by Resveratrol[5].
RANKL (mouse,10 ng/mL, 0-3 h) induces NF-κB activation in murine hepatocyte cell line (AML-12) [6].

In Vivo

RANKL (mouse, i.c.v., 5 ng in 2 μL) reduces IL-1β, MCP-1, IL-6 and TNFα expression in WT mice[4].
RANKL (mouse, i.p., 1-10 μg) protects against hepatic ischemia/reperfusion liver injury in mice[6].

Verified Bioactivity

1.Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse leukemia cellsof monocyte macrophage. The ED50 for this effect is 0.05-2.0 ng/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized mouse TNFSF11 at 10 μg/mL (100 μL/well) can bind biotinylated Human TNFRSF11B. The ED50 for this effect is 0.0848 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 is <1.808 ng/mL as measured by RAW 264.7 mouse monocyte/macrophage cells, corresponding to a specific activity of >5.531 × 105 units/mg.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized mouse TNFSF11 at 10 μg/mL (100 μL/well) can bind biotinylated Human TNFRSF11B. The ED50 for this effect is 0.0848 μg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RANKL/TNFSF11 (Q137-D316)
      Accession # O35235-1
    • C-term
  • Protein Length

    Full Length of Tumor necrosis factor ligand superfamily member 11, soluble form Chain

  • Synonyms

    TNFSF11; Tumor Necrosis Factor (Ligand) Superfamily, Member 11; TNF Superfamily Member 11; Receptor Activator Of Nuclear Factor Kappa-B Ligand; TRANCE; TNLG6B; RANKL; Receptor Activator Of Nuclear Factor Kappa B Ligand; OPGL; Tumor Necrosis Factor Ligand Superfamily Member; ODF; Tumor Necrosis Factor Superfamily Member 11; Tumor Necrosis Factor Ligand Superfamily Member 11; Tumor Necrosis Factor Ligand 6B; TNF-Related Activation-Induced Cytokine; CD254 Antigen; Osteoclast Differentiation Factor; HRANKL2; Osteoprotegerin Ligand; OPTB2; CD254; SOdf

  • AA Sequence

    QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

  • Predicted Molecular Mass

    20.1 kDa

  • Molecular Weight

    Approximately 20-29 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 1 mM EDTA, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00