1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Mouse (HEK293, C-His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    M-CSF Protein, Mouse (HEK293, C-His) purchased from MCE. Usage Cited in: Phytomedicine. 2025 Dec 10:150:157682.  [Abstract]

    The cells were resuspended in DMEM supplemented with 20% M-CSF Protein and cultured for 6 days in a humidified atmosphere containing 5% CO2 at 37 ℃. DMEM was successfully isolated from mouse tibiae, and macrophage differentiation was validated by flow cytometry analysis (CD11b+F4/80+ >95%).

    M-CSF Protein, Mouse (HEK293, C-His) purchased from MCE. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526.  [Abstract]

    Flow cytometric analysis of efferocytosis of BMDMs towards to apoptotic ECs. BMDMs were labeled with CFDA-green, and apoptotic ECs were labeled with Dil-red. M-CSF (10 ng/mL; 5 d) in the conditioned medium induced the differentiation of cells from 5 8-month-old APP/PS1 mice and age-matched WT mice into BMDMs.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    Description

    The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

    Background

    M-CSF Protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Additionally, M-CSF assumes a crucial role in the regulation of osteoclast proliferation and differentiation, influencing bone resorption, and contributing to normal bone development. Beyond its skeletal impact, M-CSF is indispensable for normal male and female fertility. The cytokine also facilitates the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, and cell migration. It further plays a role in lipoprotein clearance. M-CSF exists in multiple forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. The protein's diverse functions are mediated through its interaction with the receptor CSF1R.

    Biological Activity

    1.Measured in a cell proliferation assay using THP-1 human myeloid leukemia mononuclear cells.The ED50 for this effect is 1.325 ng/mL, corresponding to a specific activity is 7.547×105 units/mg.
    2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.0‑2.4 ng/mL.

    • Measured in a cell proliferation assay using THP-1 human myeloid leukemia mononuclear cells.The ED50 for this effect is 1.325 ng/mL, corresponding to a specific activity is 7.547×105 units/mg.
    Species

    Mouse

    Source

    HEK293

    Tag

    C-6*His

    Accession

    P07141-1 (K33-E262)

    Gene ID
    Molecular Construction
    N-term
    M-CSF (K33-E262)
    Accession # P07141
    6*His
    C-term
    Protein Length

    Partial

    Synonyms
    rMuMacrophage colony-stimulating factor 1/M-CSF, His; Macrophage colony-stimulating factor 1; CSF-1; MCSF; Csf1; Csfm
    AA Sequence

    KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

    Predicted Molecular Mass
    26 kDa
    Molecular Weight

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation

    M-CSF Protein, Mouse (HEK293, C-His) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    M-CSF Protein, Mouse (HEK293, C-His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    M-CSF Protein, Mouse (HEK293, C-His)
    Cat. No.:
    HY-P70263A
    Quantity:
    MCE Japan Authorized Agent: