M-CSF Protein, Mouse (HEK293, C-His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag. The total length of M-CSF Protein, Mouse (HEK293, C-His) is 230 a.a., with molecular weight (glycosylation form) of ~38-55 kDa.

M-CSF Protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Additionally, M-CSF assumes a crucial role in the regulation of osteoclast proliferation and differentiation, influencing bone resorption, and contributing to normal bone development. Beyond its skeletal impact, M-CSF is indispensable for normal male and female fertility. The cytokine also facilitates the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, and cell migration. It further plays a role in lipoprotein clearance. M-CSF exists in multiple forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. The protein's diverse functions are mediated through its interaction with the receptor CSF1R.

1.Measured in a cell proliferation assay using THP-1 human myeloid leukemia mononuclear cells.The ED₅₀ for this effect is 1.325 ng/mL, corresponding to a specific activity is 7.547×10⁵ units/mg.
2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is 2.258 ng/mL, corresponding to a specific activity is 4.43×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using THP-1 human myeloid leukemia mononuclear cells.The ED₅₀ for this effect is 1.325 ng/mL, corresponding to a specific activity is 7.547×10⁵ units/mg.

Mouse

HEK293

C-His

P07141 (K33-E262)

12977  [NCBI]

KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

Approximately 38-55 kDa in SDS-PAGE under reducing conditions due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.