Copy Link Print Information

M-CSF Protein, Mouse (HEK293, C-His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • M-CSF Protein, Mouse (HEK293, C-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.

Background

M-CSF Protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Additionally, M-CSF assumes a crucial role in the regulation of osteoclast proliferation and differentiation, influencing bone resorption, and contributing to normal bone development. Beyond its skeletal impact, M-CSF is indispensable for normal male and female fertility. The cytokine also facilitates the reorganization of the actin cytoskeleton, regulates the formation of membrane ruffles, cell adhesion, and cell migration. It further plays a role in lipoprotein clearance. M-CSF exists in multiple forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. The protein's diverse functions are mediated through its interaction with the receptor CSF1R.

Verified Bioactivity

1.Measured in a cell proliferation assay using THP-1 human myeloid leukemia mononuclear cells.The ED50 for this effect is 1.325 ng/mL, corresponding to a specific activity is 7.547×105 units/mg.
2.Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.0‑2.4 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P07141-1 (K33-E262)

  • Gene ID
    12977  [NCBI]
  • Molecular Construction
    • N-term
    • M-CSF (K33-E262)
      Accession # P07141
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo

  • AA Sequence

    KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE

  • Predicted Molecular Mass

    26 kDa

  • Molecular Weight

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using THP-1 human myeloid leukemia mononuclear cells.The ED50 for this effect is 1.325 ng/mL, corresponding to a specific activity is 7.547×105 units/mg.

  • 1/16

    M-CSF Protein, Mouse (HEK293, C-His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2026 Jan:150:157682. [Abstract]

    Customer Validation
     The cells were resuspended in DMEM supplemented with 20% M-CSF Protein and cultured for 6 days in a humidified atmosphere containing 5% CO2 at 37 ℃. DMEM was successfully isolated from mouse tibiae, and macrophage differentiation was validated by flow cytometry analysis (CD11b+F4/80+ >95%).

  • 1/16

    M-CSF Protein, Mouse (HEK293, C-His) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]

    Customer Validation
     Flow cytometric analysis of efferocytosis of BMDMs towards to apoptotic ECs. BMDMs were labeled with CFDA-green, and apoptotic ECs were labeled with Dil-red. M-CSF (10 ng/mL; 5 d) in the conditioned medium induced the differentiation of cells from 5 8-month-old APP/PS1 mice and age-matched WT mice into BMDMs.

  • M-CSF Protein, Mouse (HEK293, C-His) Product Image
    1/16
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for M-CSF Protein, Mouse (HEK293, C-His)
  • M-CSF Protein, Mouse (HEK293, C-His) Product Image

  • M-CSF Protein, Mouse (HEK293, C-His) purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2026 Jan:150:157682. [Abstract]

    The cells were resuspended in DMEM supplemented with 20% M-CSF Protein and cultured for 6 days in a humidified atmosphere containing 5% CO2 at 37 ℃. DMEM was successfully isolated from mouse tibiae, and macrophage differentiation was validated by flow cytometry analysis (CD11b+F4/80+ >95%).

  • M-CSF Protein, Mouse (HEK293, C-His) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2025 Sep 10:165:115526. [Abstract]

    Flow cytometric analysis of efferocytosis of BMDMs towards to apoptotic ECs. BMDMs were labeled with CFDA-green, and apoptotic ECs were labeled with Dil-red. M-CSF (10 ng/mL; 5 d) in the conditioned medium induced the differentiation of cells from 5 8-month-old APP/PS1 mice and age-matched WT mice into BMDMs.