M-CSF Protein, Cynomolgus/Rhesus Macaque (HEK293, His)
Based on 1 Customer Validation
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived M-CSF protein, expressed by HEK293 , with C-His labeled tag.
Background
M-CSF Protein assumes a crucial role in orchestrating the regulation of survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. Its significance extends to promoting the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Moreover, M-CSF is a key player in the regulation of osteoclast proliferation and differentiation, influencing bone resorption and contributing to normal bone development. Beyond its impact on the skeletal system, M-CSF is indispensable for normal male and female fertility. The cytokine also plays a role in lipoprotein clearance and contributes to cellular processes such as reorganizing the actin cytoskeleton, regulating the formation of membrane ruffles, cell adhesion, and cell migration. M-CSF can exist in various forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. It interacts with its receptor CSF1R to exert its diverse functions.
Verified Bioactivity
Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cell. The ED50 for this effect is typically 1.0-10.0 ng/mL.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-His
-
Accession
XP_005542489 (E25-N182)
-
Molecular Construction
-
N-term
-
M-CSF (E25-N182)
Accession # XP_005542489 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo
-
AA Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSGQDVVTKPDCN
-
Predicted Molecular Mass
19.8 kDa
-
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)