1. Recombinant Proteins
  2. IL-1 beta Protein, Mouse

IL-1 beta Protein, Mouse

Cat. No.: HY-P7073
Handling Instructions

IL-1 beta Protein, Mouse is a proinflammatory, cell-associated cytokine, produced by monocytes, tissue macrophages, keratinocytes and other epithelial cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $220 In-stock
Estimated Time of Arrival: December 31
50 μg $560 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE IL-1 beta Protein, Mouse

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-1β; Catabolin; IL1F2; IL-1 beta; IL1B
Species

Mouse

Source

E. coli

Accession

P10749 (V118-S269)

Gene ID

16176

Molecular Weight

Approximately 17.5 kDa

AA Sequence

MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

Biological Activity
The ED50 is <2.0 pg/mL as measured by mouse D10S cells, corresponding to a specific activity of >5.0 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

IL-1β is a potent proinflammatory cytokine, whose levels are increased in patients with alcoholic liver disease (ALD). IL-1β is produced as inactive pro–IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli, including both microbial products and endogenous danger-associated molecules. IL-1β gene expression and synthesis of pro-IL-1β occurs after activation of pattern recognition receptors (PRRs). Inflammatory stimuli also drive activation of cytosolic CARD and PYHIN domain-containing PRRs that recruit ASC and caspase-1 (Casp-1) to assemble into the multiprotein complex inflammasome. Pro-Casp-1 (encoded by pro-Casp-1), activated by the inflammasome, cleaves pro–IL-1β into the bioactive IL-1β. IL-1β acts in an autocrine/paracrine manner via the type I IL-1 receptor (IL-1R1). Activation of IL-1R1 is inhibited by its binding to the IL-1 receptor antagonist (IL-1Ra), a naturally occurring cytokine whose function is to prevent the biologic response to IL-1. Treatment with IL-1Ra significantly improves symptoms in patients with rheumatoid arthritis or autoinflammatory syndromes; unlike anti-TNF therapy, it is not associated with infectious complications[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 beta Protein, Mouse
Cat. No.:
HY-P7073
Quantity:
MCE Japan Authorized Agent: