1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 beta
  6. IL-1 beta Protein, Mouse

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions. IL-1 beta Protein, Mouse consists of 152 amino acids (V118-S269) and is expressed in E. coli.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

40 Publications Citing Use of MCE IL-1 beta Protein, Mouse

IF
IHC
Bio/Physico-chemical Assay
WB
Cell Proliferation/Viability Assay

    IL-1 beta Protein, Mouse purchased from MCE. Usage Cited in: Cancer Commun (Lond). 2025 Dec 15.

    Representative immunofluorescence micrographs showing NET formation at the MACRO stages of lung tissue with PBS, rIl-1β(8 ng; ip), anti-IgG, and anti-Il-1β antibody treatment, respectively. NETs were stained with antibodies against Mpo (red) and H3cit (green), and nuclei were counterstained with DAPI (blue).

    IL-1 beta Protein, Mouse purchased from MCE. Usage Cited in: Sci Adv. 2024 Nov 29;10(48):eadp9413.  [Abstract]

    Expression in SFO after LPS treatment. Changes in fire rates of SFO in response to IL-1β (1 nM) or TNF-α.

    IL-1 beta Protein, Mouse purchased from MCE. Usage Cited in: Sci Adv. 2024 Nov 29;10(48):eadp9413.  [Abstract]

    Changes in fire rates of SFO and OVLT neurons in response to 1nM IL-1β or TNF-α (a half hour in regular ACSF at 30°C)

    IL-1 beta Protein, Mouse purchased from MCE. Usage Cited in: Phytomedicine. 2025 Sep 19:148:157271.  [Abstract]

    WB analysis of YAP, p-YAP, and nuclear versus cytoplasmic YAP levels in HSCs treated with CM from KCs stimulated with IL-1β (10 ng/mL; 6 h) , with or without AA (8 µM).

    IL-1 beta Protein, Mouse purchased from MCE. Usage Cited in: Nat Commun. 2024 Sep 4;15(1):7712.  [Abstract]

    Cell viability of mouse primary chondrocytes treated with interleukin-1β (10 ng/mL; 48 h) in the absence or presence of 0, 2, 5, 10 nM 10-HDA .

    IL-1 beta Protein, Mouse purchased from MCE. Usage Cited in: Mil Med Res. 2022 Aug 23;9(1):46.  [Abstract]

    Pre-osteoclasts were cultured in the presence of C3 or C4 with IL-1β (40 ng/mL; 5 days) . Mature osteoclasts were harvested for TRAP staining.
    • Actividad biológica

    • Technical Parameters

    • Properties

    • Descripciòn

    • Referencias

    Descripciòn

    IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Mouse consists of 152 amino acids (V118-S269) and is expressed in E. coli.

    Background

    Interleukin-1β (IL-1β) is one of the pro-inflammatory cytokines and is produced and secreted by a variety of cell types although the vast majority of studies have focussed on its production within cells of the innate immune system, such as monocytes and macrophages[1][2].
    IL-1β is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli, including both microbial products and endogenous danger-associated molecules. IL-1β gene expression and synthesis of pro-IL-1β occurs after activation of pattern recognition receptors (PRRs). Inflammatory stimuli also drive activation of cytosolic CARD and PYHIN domain-containing PRRs that recruit ASC and caspase-1 (Casp-1) to assemble into the multiprotein complex inflammasome. Pro-Casp-1 (encoded by pro-Casp-1), activated by the inflammasome, cleaves pro-IL-1β into the bioactive IL-1β. IL-1β acts in an autocrine/paracrine manner via the type I IL-1 receptor (IL-1R1)[1][2][3].
    IL-1β could regulate the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. IL-1β also plays a significant regulator of reproduction in females[1][2][3].

    In Vitro

    IL-1β (1-15625 pg/mL; 12 hours) dose-dependently increases production of the NF-κB-dependent inflammatory cytokine TNF-α, and a significant effect of IL-1β is observed at concentrations as low as 5 pg/mL in immortalized murine RAW264.7 macrophages[1].
    IL-1β (1, 10 and 100 ng/mL; 24 hours) results in a dose-dependent increase of cell proliferation in pig heart cells. IL-1β increases the gene expression of caspase-3, and increases the enzymatic activities of MMP-2 and MMP-9[2].

    In Vivo

    IL-1β (8 ng; i.p.; daily; for 3 days) rescues Casp1−/− mice, restores survival and reduces lung bacterial load (i.e. days 0, 1, and 2 post-infection) in Chlamydia pneumoniae infected Casp1−/− mice. Yet, mice treated later (days 2, 3 and 4 post-infection) shows significantly increased bacterial counts relative to early-treated mice[3].

    Actividad biológica

    1. The ED50 is <10 pg/mL as measured by the dose-dependent stimulation of mouse D10.G4.1 helper T cells, corresponding to a specific activity of 1.0 × 108 IU/mg.
    2. Measured in a proliferation assay using CTLL-2 Mouse Embryonic Fibroblasts Cells. The ED50 is 1.802-2.776 pg/mL, corresponding to a specific activity is >3.602×108 units/mg.
    3. Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 2-10 pg/mL.

    • Measured in a proliferation assay using CTLL-2 Cells. The ED50 for this effect is 2.776 pg/mL, corresponding to a specific activity is 3.602×108 units/mg.
    Species

    Mouse

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P10749 (V118-S269)

    Gene ID
    Molecular Construction
    N-term
    IL-1β (V118-S269)
    Accession # P10749
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rMuIL-1β; Catabolin; IL1F2; IL-1 beta; IL1B
    AA Sequence

    VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

    Predicted Molecular Mass
    17.4 kDa
    Peso molecular

    Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Pureza
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 50 mM NaCl, pH 8.0.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
    2.Lyophilized from a 0.22 μm filtered solution of PBS.
    3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.8.
    4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.8, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Envío

    Room temperature in continental US; may vary elsewhere.

    Documentación
    Referencias
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Productos vistos recientemente:

    Consulta en línea

    Your information is safe with us. * Required Fields.

    IL-1 beta Protein, Mouse

     

    Requested Quantity *

    Nombre del solicitante *

     

    Saludo

    Direcciòn del E-mail *

     

    Número de teléfono *

    Department

     

    Nombre de la Organizaciòn *

    City

    Provincia

    Country or Region *

         

    Observaciones

    Consulta para venta a granel

    Inquiry Information

    Nombre del producto:
    IL-1 beta Protein, Mouse
    Cat. No.:
    HY-P7073
    Cantidad:
    MCE Japan Authorized Agent: