1. Recombinant Proteins
  2. IL-1 beta Protein, Human

IL-1 beta Protein, Human

Cat. No.: HY-P7028
Handling Instructions

IL-1 beta Protein, Human is a polypeptidic cytokine that play a key role in inflammation and immunologic reactions.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $440 In-stock
Estimated Time of Arrival: December 31
100 μg $770 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-1β; Catabolin; IL1F2; IL-1 beta; IL1B
Species

Human

Source

E. coli

Accession

P01584 (A117-S269)

Gene ID

3553

Molecular Weight

Approximately 17.3 kDa

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Biological Activity
The ED50 is <1.0 pg/mL as measured by murine D10S cells, corresponding to a specific activity of 1.0 × 109 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Interleukin-1 beta (IL-1β) is a non-glycosylated polypeptide chain containing 153 amino acids with a molecular mass of 17000 Daltons. The purified human monocyte derived IL-1 (mIL-1), a mixture of the two IL-1 forms but predominantly consisting of IL-1 beta, modulates eosinophil oxidative metabolism and enzyme secretion. Although the two major species of IL-1 (IL-1 alpha and IL-1 beta) have identical specific activities on T cells, the selective effects of human recombinant IL-1 (hrIL-1) alpha and hrIL-1 beta are reported on eosinophil function. Recombinant Human Interleukin-1 beta (hrIL-1 beta) causes a significant increase in arylsulfatase secretion (235.4±29% of resting secretion, P≤0.01) and beta-glucuronidase secretion (135.8±9.6% of resting secretion, P≤0.02) similar to mIL-1, Recombinant Human Interleukin-1 alpha (hrIL-1 alpha) has no effect on enzyme secretion. A mixture of hrIL-1 alpha and hrIL-1 beta reproduces the ability of mIL-1 to inhibit the oxidative response to suboptimal doses of phorbol myristate acetate (PMA). When eosinophils are separated into subpopulations by density gradients, eosinophil responses to IL-1 differ among the populations[1]. Members of the IL-1 family such as IL-1α and IL-1β are pro-inflammatory cytokines. Increased IL-1α and IL-1β levels have been detected separately in cigarette smoke (CS)-treated animals and inhibition of the respective signaling pathways result in anti-inflammatory activity[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 beta Protein, Human
Cat. No.:
HY-P7028
Quantity:
MCE Japan Authorized Agent: