1. Recombinant Proteins
  2. IL-1 beta Protein, Rat

IL-1 beta Protein, Rat

Cat. No.: HY-P7097
Handling Instructions

IL-1 beta Protein, Rat is an immunomodulary cytokine that mediates a wide range of immune responses.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg $780 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rRtIL-1β; Catabolin; IL1F2; IL-1 beta; IL1B
Species

Rat

Source

E. coli

Accession

Q5BKB0 (V117-S268)

Gene ID

24494

Molecular Weight

Approximately 17.3 kDa

AA Sequence

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Biological Activity
The ED50 is <10 pg/mL as measured by mouse D10S cells, corresponding to a specific activity of >1.0 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-1 beta (IL-1β) is a proinflammatory cytokine, produced in response to inflammatory agents by a variety of cells, including, monocytes, macrophages, and dendritic cells (DCs). Recombinant rat IL-1β and IL-6 synergistically enhance C3 mRNA levels and complement component C3 secretion by H-35 rat hepatoma cells. In rat hepatoma H-35 cells, recombinant rat IL-1β, IL-6, and IFN-γ increase the quantity of C3 mRNA and secreted C3 protein, an observation consistent with reports that C3 is an acute phase protein in the rat[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 beta Protein, Rat
Cat. No.:
HY-P7097
Quantity:
MCE Japan Authorized Agent: