1. Recombinant Proteins
  2. IL-1 beta Protein, Rhesus macaque

IL-1 beta Protein, Rhesus macaque

Cat. No.: HY-P7207
Handling Instructions

IL-1 beta Protein, Rhesus macaque could regulate the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $210 Ask For Quote & Lead Time
50 μg $650 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rRhIL-1β; IL1B
Species

Rhesus Macaque

Source

E. coli

Accession

P48090 (A117-S269)

Gene ID

704701

Molecular Weight

Approximately 17.3 kDa

AA Sequence

APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS

Biological Activity
The ED50 is <10 pg/mL as measured by murine D10.G4.1 cells, corresponding to a specific activity of >1.0 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

IL1β is apro-inflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. IL1β bind to the same receptor and have similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity, and the ability to stimulate the release of prostaglandin and collagenase from synovial cells[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 beta Protein, Rhesus macaque
Cat. No.:
HY-P7207
Quantity:
MCE Japan Authorized Agent: