1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-1
  5. IL-1 beta
  6. IL-1 beta Protein, Porcine

IL-1 beta Protein, Porcine

Cat. No.: HY-P7206
Handling Instructions

IL-1 beta Protein, Porcine could regulate the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

IL-1 beta Protein, Porcine Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Porcine

Source

E. coli

Accession

P26889 (A115-P267)

Gene ID

397122

Synonyms
rPoIL-1β; IL1B
AA Sequence

MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Molecular Weight

Approximately 17.7 kDa

Biological Activity
The ED50 is <1 ng/mL as measured by mouse D10S cells, corresponding to a specific activity of >1.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-1 beta (IL-1 β) is one of the major inflammatory cytokines found in atherosclerotic lesions[1]. Interleukin-1β (IL-1β) acts throughout the IL-1β system, which contains IL-1β and the IL-1β receptor (IL-1R), accessory protein (IL-1RacP), and receptor antagonist (IL-1Ra). In pigs, the expression of the members of the IL-1β system was documented in uterine tissues during the oestrous cycle and early pregnancy, as well as in embryos harvested during the peri-implantation period[2]. Interleukin-1 beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells[3].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 beta Protein, Porcine
Cat. No.:
HY-P7206
Quantity:
MCE Japan Authorized Agent: