IL-4 Protein, Mouse (HEK293)

IL-4 Protein, Mouse (HEK293) is a species-specific cytokine which promotes the proliferation, differentiation and cell-surface protein modulation of B lymphocytes.

Mouse Interleukin 4 is a 20-kDa glycoprotein, synthesized by activated T lymphocytes and mast cells, which regulates the growth and/or differentiation of a broad spectrum of target cells of the immune system, including B and T lymphocytes, macrophages, and hematopoietic progenitor cells. Murine Interleukin 4 (IL-4) is a potent mediator of an immune response, affecting both the growth and differentiation of a wide variety of cells in the hematopoietic lineage. This cytokine is expressed by activated T lymphocytes and mast cells as a 20-kDa glycoprotein. The cDNA for IL-4 isinitially is solated by two laboratories, using expression vectors and screening for either a IgG-inducing factor or a mast cell growth factor. The derived amino acid sequence from the cDNA clones is used to predict a protein backbone for IL-4 of 14 kDa. This is consistent with the observation that N-glycanase treatment of natural IL-4, to remove N-linked carbohydrates, yields a protein core of 14 kDa. Initial experiments with deglycosylated native IL-4 and with deglycosylated recombinant IL-4, expressed initially in yeast as a heterogeneous, hyperglycosylated molecule, suggested that the carbohydrate modifications of IL-4 do not affect its ability to bind to receptor and to stimulate T and B cell growth^[1].

Measured in a cell proliferation assay using HT-2 cells. The ED₅₀ for this effect is 0.1-1.5 ng/mL.

• 
  Measured in a cell proliferation assay using HT-2 cells.The ED₅₀ for this effect is 0.1049 ng/mL, corresponding to a specific activity is 9.533×10⁶ units/mg.

Mouse

HEK293

Tag Free

P07750 (H21-S140)

16189  [NCBI]

Full Length of Mature Protein

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Approximately 19.2 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O or PBS.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.