GM-CSF Protein, Mouse (His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse (His) is a recombinant GM-CSF Protein expressed by E. coli with a N-6*His tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

GM-CSF Protein is a hematopoietic growth factor and immunomodulator. By binding to specific receptors on the surface of target cells, GM-CSF Protein activates intracellular signaling pathways to regulate cell proliferation, differentiation, maturation, and function. GM-CSF Protein plays an important role in the hematopoietic process and the immune system. GM-CSF Protein, Mouse (His) is a recombinant GM-CSF Protein expressed by E. coli with a N-6*His tag[1][2][3][4].

Background

GM-CSF is a cytokine secreted by various cells (such as T cells, monocytes, endothelial cells, etc.), playing an important role in the immune system and hematopoietic process. GM-CSF can stimulate the proliferation and differentiation of precursor cells of granulocytes (such as neutrophils and eosinophils) and macrophages in the bone marrow, promoting the production of mature blood cells. GM-CSF can also activate mature granulocytes and macrophages, enhancing their phagocytic ability, bactericidal activity, and antigen-presenting function, and participating in innate and adaptive immune responses. In addition, GM-CSF also has pro-inflammatory activity[1][2][3][4].

In Vitro

GM-CSF Protein (25 ng/mL; 30 min-24 h) enhances glycolytic capacity in mouse bone marrow-derived macrophages, upregulates the expression of glucose transporters GLUT-1, -3, and -4, and induces the transcription and protein expression of c-Myc[5].

In Vivo

GM-CSF Protein (2-4 ng; aerosol inhalation; 4-5 weeks) improves pulmonary alveolar proteinosis in GM-CSF-deficient mice[6].

Verified Bioactivity

1.Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is 9.304-24.86 pg/mL, corresponding to a specific activity is 4.023×107-1.075×108 units/mg.
2.Measured by its binding ability in a functional ELISA. Immobilized Mouse GM-CSF at 5 μg/mL (100 μl/well) can bind Biotinylated Mouse GM-CSF R alpha. The ED50 for this effect is 0.01-0.156 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using THP-1 human erythroleukemic cells. The ED50 for this effect is 9.304-24.86 pg/mL, corresponding to a specific activity is 4.023×107-1.075×108 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • GM-CSF (A18-K141)
      Accession # Q14AD9
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colo

  • AA Sequence

    APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

  • Predicted Molecular Mass

    14.1 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00