Copy Link Print Information

IFN-gamma Protein, Human

80 Cited Publications
Customer Review

Based on 80 publication(s) in Google Scholar

IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • IFN-gamma Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-gamma Protein, human activates STAT signaling pathway and affects gene regulation. IFN-gamma Protein, human activates effector immune cells and enhances antigen presentation. IFN-gamma Protein, human also regulates the hematopoietic stem cells development. IFN-gamma Protein, human is the recombinant human-derived IFN-gamma Protein, expressed by E. coli.

Background

Human Interferon-gamma (hIFNγ) is naturally produced by CD4+ T helper cell type 1 (Th1) lymphocytes, CD8+ cytotoxic lymphocytes, natural killer (NK) cells, B cells, NKT cells, and professional antigen-presenting cells (APCs). Secretion of hIFNγ by NK cells and APCs is important in early host reactions against infection while production of hIFNγ by T lymphocytes is important in the adaptive immune response. hIFNγ shows antiviral and antitumor activity and is involved in complex interactions of cellular metabolism and differentiation[1]. Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory propertiy. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins[2].

In Vitro

IFN-gamma Protein (human, 0-1000 ng/mL, 12-18 h) induces IFN-γ-inducible protein-16 (IFI16) accumulation in A549 nucleus and cytoplasm[3].
IFN-gamma Protein (human, 100 ng/mL, 24 h) promotes the PD-L1 expression, activates PI3K/Akt and ERK1/2 signaling pathways, increases the CD44+/CD24- cell ratio, and enhances cell sphere formation ability. IFN-gamma Protein promotes the stemness of breast cancer cell MCF-7[4].

Verified Bioactivity

The ED50 is <1 ng/mL as measured by its ability to inhibit the proliferation of HT-29 cells., corresponding to a specific activity of >1 × 106 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P01579 (Q24-Q166)

  • Gene ID
    3458  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-gamma (Q24-Q166)
      Accession # P01579
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

  • Predicted Molecular Mass

    16.7 kDa

  • Molecular Weight

    Approximately 16-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5 % trehalose, 5% mannitol, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, 5% mannitol, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Razaghi A, et al. Review of the recombinant human interferon gamma as an immunotherapeutic: Impacts of production platforms and glycosylation. J Biotechnol. 2016 Dec 20;240:48-60. [Content Brief]

[2]. Fam CM, et al. PEGylation improves the pharmacokinetic properties and ability of interferon gamma to inhibit growth of a human tumor xenograft in athymic mice. J Interferon Cytokine Res. 2014 Oct;34(10):759-68. [Content Brief]

[3]. Jiang Z, et al., IFI16 directly senses viral RNA and enhances RIG-I transcription and activation to restrict influenza virus infection. Nat Microbiol. 2021 Jul;6(7):932-945. [Content Brief]

[4]. Gao L, et al., MiR-873/PD-L1 axis regulates the stemness of breast cancer cells. EBioMedicine. 2019 Mar;41:395-407. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Nov 11. [Abstract]

    Customer Validation
     Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 under different TSPAN13 expression levels, with or without IFNγ (30 ng/mL, 24 h) stimulation.

  • 1/16

    IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]

    Customer Validation
     Protein expression levels of TAP1, PD-L1 and β2M after nintedanib combined with IFN-γ (10 ng/mL, 24 h) treated.

  • 1/16

    IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]

    Customer Validation
     The regulation of STM2457 on the total expression of PD-L1 protein was detected using Western blot in A549 and H1975 cells treated with STM2457 (0, 0.05, 0.5, 5, and 50 mM) with interferon-gamma (IFN-g) induction (10 ng/mL) for 24 h.

  • 1/16

    IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945. [Abstract]

    Customer Validation
     IFI16 expression in A549 cells treated with IFN-γ (50, 500, 1000 ng/mL) for 18 h was determined.

  • 1/16

    IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945. [Abstract]

    Customer Validation
     Intracellular localization of IFI16 in A549 cells treated with poly(I:C) or IFN-γ (500 ng/mL) for 12 h was determined.

  • IFN-gamma Protein, Human Product Image
    1/16
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • Experimental Validation Results for IFN-gamma Protein, Human
  • IFN-gamma Protein, Human Product Image

  • IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Cancer Res. 2025 Nov 11. [Abstract]

    Flow cytometry was used to assess the surface expression levels of MHC-I in MDA-MB-468 under different TSPAN13 expression levels, with or without IFNγ (30 ng/mL, 24 h) stimulation.

  • IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]

    Protein expression levels of TAP1, PD-L1 and β2M after nintedanib combined with IFN-γ (10 ng/mL, 24 h) treated.

  • IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Theranostics. 2022 Jan 1;12(2):747-766. [Abstract]

    The regulation of STM2457 on the total expression of PD-L1 protein was detected using Western blot in A549 and H1975 cells treated with STM2457 (0, 0.05, 0.5, 5, and 50 mM) with interferon-gamma (IFN-g) induction (10 ng/mL) for 24 h.

  • IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945. [Abstract]

    IFI16 expression in A549 cells treated with IFN-γ (50, 500, 1000 ng/mL) for 18 h was determined.

  • IFN-gamma Protein, Human purchased from MedChemExpress. Usage Cited in: Nat Microbiol. 2021 Jul;6(7):932-945. [Abstract]

    Intracellular localization of IFI16 in A549 cells treated with poly(I:C) or IFN-γ (500 ng/mL) for 12 h was determined.