Copy Link Print Information

IFN-gamma Protein, Human (HEK293)

7 Cited Publications
Customer Review

Based on 7 publication(s) in Google Scholar

IFN-gamma is a cytokine. IFN-gamma can exert anticancer effects by activating p53 and p21, leading to cell cycle arrest, and/or by activating IRF-1 and Caspase-1, leading to pyroptosis, and by activating IRF-1, Caspase-8, cytochrome c release from mitochondria, Caspase cascades, and inhibiting PARP, leading to intrinsic apoptotic signaling. IFN-gamma can induce fusion of human monocytes to form multinucleated giant cells and activate monocytes, increasing their ability to produce hydrogen peroxide, acid phosphatase, and plasminogen activator. IFN-gamma can enhance the sensitivity of human macrophages to lysis mediated by extracellular ATP. IFN-gamma upregulates the transcription and expression of TNF-α by inhibiting the expression of IL-10 and relieving the feedback inhibition of IL-10 on TNF-α. IFN-gamma Protein, Human (HEK293) is a recombinant interferon-gamma protein expressed in HEK293 cells without a tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • IFN-gamma Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-gamma is a cytokine. IFN-gamma can exert anticancer effects by activating p53 and p21, leading to cell cycle arrest, and/or by activating IRF-1 and Caspase-1, leading to pyroptosis, and by activating IRF-1, Caspase-8, cytochrome c release from mitochondria, Caspase cascades, and inhibiting PARP, leading to intrinsic apoptotic signaling. IFN-gamma can induce fusion of human monocytes to form multinucleated giant cells and activate monocytes, increasing their ability to produce hydrogen peroxide, acid phosphatase, and plasminogen activator. IFN-gamma can enhance the sensitivity of human macrophages to lysis mediated by extracellular ATP. IFN-gamma upregulates the transcription and expression of TNF-α by inhibiting the expression of IL-10 and relieving the feedback inhibition of IL-10 on TNF-α. IFN-gamma Protein, Human (HEK293) is a recombinant interferon-gamma protein expressed in HEK293 cells without a tag.

Background

IFN-gamma belongs to the interferon family. IFN-gamma is a cytokine[1]. IFN-gamma can exert anticancer effects by activating p53 and p21, leading to cell cycle arrest, and/or by activating IRF-1 and Caspase-1, leading to pyroptosis, and by activating IRF-1, Caspase-8, cytochrome c release from mitochondria, caspase cascades, and inhibiting PARP, leading to intrinsic apoptotic signaling[1]. IFN-gamma can induce fusion of human monocytes to form multinuclear giant cells and activate monocytes, increasing their ability to produce hydrogen peroxide, acid phosphatase, and plasminogen activator[2]. IFN-gamma can enhance the sensitivity of human macrophages to lysis mediated by extracellular ATP[3]. IFN-gamma upregulates the transcription and expression of TNF-α by inhibiting the expression of IL-10 and relieving the feedback inhibition of IL-10 on TNF-α[4]. IFN-gamma can be produced by CD4+ T helper type 1 lymphocytes, CD8+ cytotoxic lymphocytes, and natural killer (NK) cells[1]. The active form of IFN-gamma, Human is a soluble homodimer with two N-glycosylation sites on the surface of each dimer, at asparagine (N25 and N97). The glycan at N25 is fucosylated, primarily as a complex sialylated oligosaccharide composed of sialic acid, galactose, mannose, N-acetylglucosamine, and fucose, whereas the glycan at N97 is a non-fucosylated hybrid high-mannose structure with a sugar composition of sialic acid, galactose, mannose, and N-acetylglucosamine[1].

In Vitro

IFN-γ, Human (HEK293) (100 ng/mL; 72 h) induces cell death and G2 cell cycle arrest in the ovarian cancer cell line PEO1[1].
IFN-γ, Human (E. coli) (0.1-1 nM) induces multinuclear giant cell formation and enhances H2O2 production and lysosomal enzyme activity in human monocyte cultures[2].
IFN-γ, Human (1-100 ng/mL; 4-18 h) inhibits IL-10 mRNA and protein expression and dose-dependently upregulates TNF-α transcript and protein levels in LPS-stimulated human monocytes[4].

Verified Bioactivity

Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells.The ED50 for this effect is 0.4003-0.61 ng/mL, corresponding to a specific activity is 1.639×106-2.498×106 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 0.1895 ng/mL, corresponding to a specific activity is 5.277×106 Unit/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    P01579 (Q24-Q166)

  • Gene ID
    3458  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-gamma (Q24-Q166)
      Accession # P01579
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

  • Predicted Molecular Mass

    16.8 kDa

  • Molecular Weight

    Approximately 20-24 kDa & 16-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Razaghi A, et al. Improved therapeutic efficacy of mammalian expressed-recombinant interferon gamma against ovarian cancer cells. Exp Cell Res. 2017 Oct 1;359(1):20-29. [Content Brief]

[2]. Weinberg JB, et al. Recombinant human gamma-interferon induces human monocyte polykaryon formation. Proc Natl Acad Sci U S A. 1984 Jul;81(14):4554-7. [Content Brief]

[3]. Blanchard DK, et al. IFN-gamma enhances sensitivity of human macrophages to extracellular ATP-mediated lysis. J Immunol. 1991 Oct 15;147(8):2579-85. [Content Brief]

[4]. Donnelly RP, et al. Inhibition of IL-10 expression by IFN-gamma up-regulates transcription of TNF-alpha in human monocytes. J Immunol. 1995 Aug 1;155(3):1420-7. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit the proliferation of HT-29 cells. The ED50 for this effect is 0.1895 ng/mL, corresponding to a specific activity is 5.277×106 Unit/mg.

  • 1/16

    IFN-gamma Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: iScience. 2025 Sep 5;28(10):113517. [Abstract]

    Customer Validation
     THP-1-derived macrophages polarization were induced by IFN-γ (10 ng/mL; 48 h) + LPS (M1), IL-4 (M2a), or IL-10 (M2c).

  • 1/16

    IFN-gamma Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: bioRxiv. 2025 Jun 13:2025.06.12.659131. [Abstract]

    Customer Validation
     EV and JUNB KO cells were left untreated or treated with 10 ng/ml TNFα or 10 ng/ml IFNγ for 24 hours and harvested for RNA.

  • IFN-gamma Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • Experimental Validation Results for IFN-gamma Protein, Human (HEK293)
  • IFN-gamma Protein, Human (HEK293) Product Image