IFN-gamma Protein, Mouse (HEK293, His)
Based on 1 publication(s) in Google Scholar
IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with C-6*His labeled tag.
Background
IFN-gamma is produced by immune cells such as T cells and NK cells, and plays a key role in antibacterial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation[1][2][5][6].FN-gamma is involved in the regulation of hematopoietic stem cells under developmental and steady-state conditions by affecting their development, quiescence, and differentiation[3][4].IFN-gamma increases the susceptibility of cancer cells to external and internal apoptosis pathways by regulating the expression of Fas/FasL, TNF-related apoptosis-inducing ligand (TRAIL), caspase-8, -3, -7, and -1, survivin, and Bim[5].IFN-gamma mainly interacts with its receptor IFNGR1 through the JAK-STAT pathway to affect gene regulation. After binding to the receptor, the intracellular domain of IFNGR1 opens, allowing downstream signaling elements JAK2, JAK1, and STAT1 to bind, resulting in STAT1 activation, nuclear translocation, and IFN-gamma-regulated gene transcription[6].IFN-gamma achieves antiviral effects by inducing RNA-activated protein kinase R (PKR) and adenosine deaminase RNA-specific-1 (ADAR-1) to activate antiviral proteins[6].IFN-gamma can inhibit the production of IL-4 by TH1 cells and maintain the sustained expression of T-bet[7].As a central effector of cell-mediated immunity, IFN-gamma can enhance antigen recognition through interactions with homologous T cells, amplify antigen presentation through antigen-presenting cells (APCs), increase the production of reactive oxygen species (ROS) and reactive nitrogen intermediates (RNIs), and induce antiviral responses[8].
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P01580 (H23-C155)
-
Molecular Construction
-
N-term
-
IFN-gamma (H23-C155)
Accession # P01580 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon
-
AA Sequence
HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
-
Predicted Molecular Mass
16.6 kDa
-
Molecular Weight
Approximately 15-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, 5% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Huang S, et al. Immune response in mice that lack the interferon-gamma receptor. Science. 1993 Mar 19;259(5102):1742-5. [Content Brief]
[2]. Pearl JE, et al. Inflammation and lymphocyte activation during mycobacterial infection in the interferon-gamma-deficient mouse. Cell Immunol. 2001 Jul 10;211(1):43-50. [Content Brief]
[3]. Baldridge MT, et al. Quiescent haematopoietic stem cells are activated by IFN-gamma in response to chronic infection. Nature. 2010 Jun 10;465(7299):793-7. [Content Brief]
[4]. Matatall KA, et al. Type II interferon promotes differentiation of myeloid-biased hematopoietic stem cells. Stem Cells. 2014 Nov;32(11):3023-30. [Content Brief]
[5]. Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81. [Content Brief]
[6]. Kak G, et al. Interferon-gamma (IFN-γ): Exploring its implications in infectious diseases. Biomol Concepts. 2018 May 30;9(1):64-79. [Content Brief]
[7]. Afkarian M, et al. T-bet is a STAT1-induced regulator of IL-12R expression in naïve CD4+ T cells. Nat Immunol. 2002 Jun;3(6):549-57. [Content Brief]
[8]. Schroder K, et al. Interferon-gamma: an overview of signals, mechanisms and functions. J Leukoc Biol. 2004 Feb;75(2):163-89. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
