IFN-gamma Protein, Ferret (HEK293, His)

IFN-gamma is a type II interferon derived from immune cells such as T cells and NK cells that crucially activates antibacterial, antiviral and antitumor responses through the JAK-STAT pathway and its receptor IFNGR1 .Binding opens the intracellular domain of IFNGR1, activating downstream components (JAK2, JAK1, STAT1), leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. IFN-gamma Protein, Ferret (HEK293, His) is the recombinant IFN-gamma protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IFN-gamma is a type II interferon derived from immune cells such as T cells and NK cells that crucially activates antibacterial, antiviral and antitumor responses through the JAK-STAT pathway and its receptor IFNGR1 .Binding opens the intracellular domain of IFNGR1, activating downstream components (JAK2, JAK1, STAT1), leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. IFN-gamma Protein, Ferret (HEK293, His) is the recombinant IFN-gamma protein, expressed by HEK293 , with C-His labeled tag.

Background

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells such as T-cells and NK cells, assumes crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling occurs through the JAK-STAT pathway upon interaction with its receptor, IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain opens out, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1, leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors, such as IRF1, capable of further driving the regulation of a subsequent wave of transcription. IFN-gamma also plays a role in the class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby increasing the quantity, quality, and repertoire of peptides for class I MHC loading. It enhances the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Additionally, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participating in the regulation of hematopoietic stem cells during development and under homeostatic conditions, IFN-gamma influences their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization to orchestrate its diverse and critical functions in immune responses and hematopoiesis.

Technical Parameters

  • Species Others
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IFN-gamma (Q24-K166)
      Accession # A4PIZ9
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon

  • AA Sequence

    QAMFFKEIEDLKEYFNASNPDVADGGPLFLDILKNWREESDKKIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLVRFFNNSSSKLEDFLKLIRIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSHSLFRGRRASK

  • Predicted Molecular Mass

    18.4 kDa

  • Molecular Weight

    Approximately 28 kDa & 23 kDa & 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00