IFN-gamma Protein, Ferret (HEK293, His)
IFN-gamma is a type II interferon derived from immune cells such as T cells and NK cells that crucially activates antibacterial, antiviral and antitumor responses through the JAK-STAT pathway and its receptor IFNGR1 .Binding opens the intracellular domain of IFNGR1, activating downstream components (JAK2, JAK1, STAT1), leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. IFN-gamma Protein, Ferret (HEK293, His) is the recombinant IFN-gamma protein, expressed by HEK293 , with C-His labeled tag.
- Species: Others
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IFN-gamma is a type II interferon derived from immune cells such as T cells and NK cells that crucially activates antibacterial, antiviral and antitumor responses through the JAK-STAT pathway and its receptor IFNGR1 .Binding opens the intracellular domain of IFNGR1, activating downstream components (JAK2, JAK1, STAT1), leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. IFN-gamma Protein, Ferret (HEK293, His) is the recombinant IFN-gamma protein, expressed by HEK293 , with C-His labeled tag.
Background
IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells such as T-cells and NK cells, assumes crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling occurs through the JAK-STAT pathway upon interaction with its receptor, IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain opens out, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1, leading to STAT1 activation, nuclear translocation, and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors, such as IRF1, capable of further driving the regulation of a subsequent wave of transcription. IFN-gamma also plays a role in the class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby increasing the quantity, quality, and repertoire of peptides for class I MHC loading. It enhances the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Additionally, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participating in the regulation of hematopoietic stem cells during development and under homeostatic conditions, IFN-gamma influences their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization to orchestrate its diverse and critical functions in immune responses and hematopoiesis.
Technical Parameters
-
Species Others
-
Source HEK293
-
Tag C-His
-
Accession
A4PIZ9 (Q24-K166)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IFN-gamma (Q24-K166)
Accession # A4PIZ9 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon
-
AA Sequence
QAMFFKEIEDLKEYFNASNPDVADGGPLFLDILKNWREESDKKIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLVRFFNNSSSKLEDFLKLIRIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSHSLFRGRRASK
-
Predicted Molecular Mass
18.4 kDa
-
Molecular Weight
Approximately 28 kDa & 23 kDa & 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)