1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Enzymes & Regulators Kinases
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases TK
  4. INSR/CD220 Insulin Receptor (INSR) InsR
  5. Insulin R/CD220 Protein, Human (Active, sf9, His-GST)

Insulin R/CD220 Protein, Human (Active, sf9, His-GST)

Cat. No.: HY-P73244
Handling Instructions Technical Support

The insulin R/CD220 protein is a receptor tyrosine kinase that coordinates insulin action by phosphorylating substrates such as IRS and SHC upon insulin binding. Phosphorylated IRS activates PI3K-AKT/PKB to exert metabolic effects, and activates Ras-MAPK to promote growth and differentiation. Insulin R/CD220 Protein, Human (sf9, His-GST) is the recombinant human-derived Insulin R/CD220 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The insulin R/CD220 protein is a receptor tyrosine kinase that coordinates insulin action by phosphorylating substrates such as IRS and SHC upon insulin binding. Phosphorylated IRS activates PI3K-AKT/PKB to exert metabolic effects, and activates Ras-MAPK to promote growth and differentiation. Insulin R/CD220 Protein, Human (sf9, His-GST) is the recombinant human-derived Insulin R/CD220 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

The Insulin R/CD220 protein, a receptor tyrosine kinase, orchestrates the diverse actions of insulin through the phosphorylation of multiple intracellular substrates upon insulin binding. These substrates include insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL, and other signaling intermediates. Phosphorylated IRS proteins activate two main signaling pathways: the PI3K-AKT/PKB pathway, pivotal for insulin's metabolic effects, and the Ras-MAPK pathway, which collaborates with PI3K to regulate cell growth and differentiation. The PI3K-AKT/PKB pathway triggers the translocation of the glucose transporter SLC2A4/GLUT4 to the cell membrane, facilitating glucose transport. Activated AKT/PKB, a downstream effector, induces an anti-apoptotic effect by phosphorylating BAD, regulates the expression of metabolic enzymes, and modulates the mTORC1 signaling pathway, integrating insulin signals for cell growth and metabolism. The Ras/RAF/MAP2K/MAPK pathway mediates insulin-induced cell growth, survival, and cellular differentiation. In addition to insulin, the receptor can bind insulin-like growth factors (IGFI and IGFII). Hybrid receptors composed of IGF1R and INSR isoforms exhibit varying affinities for IGFs and insulin, influencing their activation patterns. Furthermore, in adipocytes, the receptor inhibits lipolysis.

Biological Activity

The specific activity was determined to be >45 nmol/min/mg using Poly (Ala,Glu,Lys,Tyr) 6:2:5:1 as substrate.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P06213-1/NP_000199.2 (G989-S1382)

Gene ID
Molecular Construction
N-term
His-GST
INSR (G989-S1382)
Accession # P06213-1/NP_000199.2
C-term
Protein Length

Partial

Synonyms
CD 220; HHF5; INSR; Insulin R; Insulin receptor; IR
AA Sequence

GPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS

Molecular Weight

Approximately 75 kDa

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 7.4, 20% glycerol, 0.3 mM DTT.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Insulin R/CD220 Protein, Human (Active, sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin R/CD220 Protein, Human (Active, sf9, His-GST)
Cat. No.:
HY-P73244
Quantity:
MCE Japan Authorized Agent: