1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. IP-10/CXCL10
  6. IP-10/CXCL10 Protein, Human

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
2 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg Auf Lager
> 100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

IP-10/CXCL10 Protein, Human Spezialitätsempfehlungen:

Top Publications Citing Use of Products
In Vivo Efficacy Study
Cell Migration/Invasion Assay
Cell Proliferation/Viability Assay
Histological Imaging/Staining
Flow Cytometry

    IP-10/CXCL10 Protein, Human purchased from MCE. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442.  [Abstract]

    In the KPC xenograft model, compared to the PBS control group (administered every 3 days), the tumor volume in the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) were significantly reduced.

    IP-10/CXCL10 Protein, Human purchased from MCE. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442.  [Abstract]

    In the KPC xenograft model, compared to the PBS control group (administered every 3 days), the tumor weight in the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) were significantly reduced.

    IP-10/CXCL10 Protein, Human purchased from MCE. Usage Cited in: Oncoimmunology. 2025 Dec;14(1):2539442.  [Abstract]

    In the KPC xenograft model, compared with the PBS control group (administered every 3 days), the IP-10/CXCL10 Protein, Human protein treatment group (50 µg/kg, intratumoral injection every 3 days) showed a significant increase in CD8+ T cell infiltration in tumor tissue.

    IP-10/CXCL10 Protein, Human purchased from MCE. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245.  [Abstract]

    The significantly enhanced of migration in the SKOV3 cell line with the addition of CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 10 h).

    IP-10/CXCL10 Protein, Human purchased from MCE. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245.  [Abstract]

    The significantly enhanced invasion in the SKOV3 cell line with the addition of CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 12 h).

    IP-10/CXCL10 Protein, Human purchased from MCE. Usage Cited in: J Ovarian Res. 2024 Dec 19;17(1):245.  [Abstract]

    The apoptosis of SKOV3 cells treated with or without CXCL10 (IP-10/CXCL10 Protein, Human, 200 ng/mL, 24 h).
    • Biologische Aktivität

    • Technical Parameters

    • Properties

    • Beschreibung

    • Verweise

    Beschreibung

    CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

    Background

    CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
    Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
    Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
      CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].

    In Vitro

    Recombinant human CXCL10 (5-10 μg/mL; 3 days) attenuates the proliferation of CAG, U266 and RPMI-8266 myeloma cells, and human umbilical vein endothelial cells, implying that CXCL10 exhibits anti-angiogenic capacity[2].
    Recombinant human CXCL10 (500 ng//mL; for 2 h) induces up-regulation of CXCR3 expression in MDA-MB-231, MCF-7 and T47D cells[3].

    Biologische Aktivität

    1.The ED50 is <0.2 μg/mL as measured by HUVEC cells, corresponding to a specific activity of >5.0 × 103 units/mg.
    2.Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 45.45 ng/mL, corresponding to a specific activity is 2.200×104 U/mg.
    3.Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Human CXCR3. The ED50 for this effect is <0.18 μg/mL.

    • Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 45.45 ng/mL, corresponding to a specific activity is 2.200×104 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P02778 (V22-P98)

    Gene ID
    Molecular Construction
    N-term
    CXCL10 (M22-P98)
    Accession # P02778
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuIP-10/CXCL10; C-X-C motif chemokine 10; Gamma-IP10; Mob-1
    AA Sequence

    VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

    Predicted Molecular Mass
    8.6 kDa
    Molekulargewicht

    Approximately 11-13 kDa, based on SDS-PAGE under reducing conditions.

    Reinheit
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, pH 8.0.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Versand

    Room temperature in continental US; may vary elsewhere.

    Dokumentation
    Verweise

    IP-10/CXCL10 Protein, Human Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Ihre kürzlich angesehenen Produkte:

    Online-Anfrage

    Your information is safe with us. * Required Fields.

    IP-10/CXCL10 Protein, Human

     

    Requested Quantity *

    Name des Antragstellers *

     

    Anrede

    E-Mail-Addresse *

     

    Telefonnummer *

    Department

     

    Name der Organisation *

    City

    Bundesland

    Country or Region *

         

    Bemerkungen

    Massenanfrage

    Inquiry Information

    Produktname:
    IP-10/CXCL10 Protein, Human
    Art. -Nr.:
    HY-P7226
    Menge:
    MCE Japan Authorized Agent: