Copy Link Print Information

IP-10/CRG-2/CXCL10 Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. IP-10/CRG-2/CXCL10 Protein, Mouse consists of 77 amino acids (I22-P98) and is expressed in E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • IP-10/CRG-2/CXCL10 Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CRG-2/CXCL10 Protein, Mouse consists of 77 amino acids (I22-P98) and is expressed in E. coli.

Background

CXCL10 is a pro-inflammatory chemokine secreted by a wide spectrum of cells. CXCL10 activates T lymphocytes (Th1), NK cells, macrophages, dendritic and B cells. Alterations in CXCL10 expression levels have been associated with inflammatory diseases including infectious diseases, angiogenesis, immune dysfunction and tumor development[1].
Mature human CXCL10 shares 68% amino acid sequence identity with mouse and rat CXCL10.
Human CXCL10 gene, is initially isolated in 1985 by Luster while treating a lymphoma cell line (U937) with recombinant IFN-γ. CXCL10 cDNA has an open reading frame of 1173-bp containing 4 exons and encoding a protein of 98-amino acids. The primary translational product of the CXCL10 gene is a 12 kDa protein containing two internal disulfide cross bridges. CXCL10 exerts its biological effects by binding to CXCR3, a seven trans-membrane-spanning G protein-coupled receptor in a paracrine or autocrine fashion, which is predominantly expressed on activated T, B lymphocyte, natural killer (NK), dendritic and macrophage cells. CXCL10 induction depends predominantly on the carboxyl-terminal region of CXCR3, which is essential for CXCR3 internalization, chemotaxis and calcium mobilization induced by the CXCL10 ligand. The powerful chemotactic action of CXCL10 on activated lymphocytes allows it to modulate both innate and adaptive immunity, inducing tissue damage and modulating tumor formation[1].
  CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer. ELR-negative CXCL10 is an angiostatic chemokine, which inhibits angiogenesis. Abnormal levels of CXCL10 have been observed in body fluids of individuals infected with viruses, bacteria, fungi and parasites[1].

In Vitro

Recombinant mouse CXCL10 protein (1, 10, or 100 ng/mL; for 72 h) shows strongly chemotactic to the astrocytes[4].

In Vivo

Mice are pretreated with recombinant mouse CXCL10 (2 mg/kg/day, i.v.) or vehicle for 3 days, and injected with BrdU 24 h after final pretreatment. CXCL10 inhibits crypt cell proliferation and migration in vivo[2].
In Bleomycin-treated mice, recombinant mouse CXCL10 (1 μg/20 μL; daily; for 13 days) is given to mice intramuscularly daily. CXCL10 inhibits primary lung fibroblast migration during fibrosis in WT mice, but not in Sdc4–/– mice[3].

Verified Bioactivity

1.Full biological activity determined by a chemotaxis bioassay using human peripheral blood lymphocytes is in a concentration range of 0.1-10.0 ng/ml in the presence of IL-2.
2.Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR3. The ED50 for this effect is 0.2587 µg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P17515 (I22-P98)

  • Gene ID
    15945  [NCBI]
  • Molecular Construction
    • N-term
    • CXCL10 (I22-P98)
      Accession # P17515
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL10; Small Inducible Cytokine Subfamily B (Cys-X-Cys), Member 10; Prev. SCYB10; Small-Inducible Cytokine B10; Prev. INP10; C-X-C Motif Chemokine 10; IP-10; Protein 10 From Interferon (Gamma)-Induced Cell Line; GIP-10; Interferon-Inducible Cytokine IP-1

  • AA Sequence

    IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

  • Predicted Molecular Mass

    8.7 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 2×PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Liu M, et al. CXCL10/IP-10 in infectious diseases pathogenesis and potential therapeutic implications. Cytokine Growth Factor Rev. 2011 Jun;22(3):121-30. [Content Brief]

[2]. Liu M, et al. CXCL10/IP-10 in infectious diseases pathogenesis and potential therapeutic implications. Cytokine Growth Factor Rev. 2011 Jun;22(3):121-30. [Content Brief]

[3]. Shunya Sasaki, et al. Blockade of CXCL10 protects mice from acute colitis and enhances crypt cell survival. Eur J Immunol. 2002 Nov;32(11):3197-205. [Content Brief]

[4]. Dianhua Jiang, et al. Inhibition of pulmonary fibrosis in mice by CXCL10 requires glycosaminoglycan binding and syndecan-4. J Clin Invest. 2010 Jun;120(6):2049-57. [Content Brief]

[5]. Shinrye Lee, et al. Lipocalin-2 Is a chemokine inducer in the central nervous system: role of chemokine ligand 10 (CXCL10) in lipocalin-2-induced cell migration. J Biol Chem. 2011 Dec 23;286(51):43855-43870. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR3. The ED50 for this effect is 0.2587 µg/mL, corresponding to a specific activity is 3865.481 U/mg.

  • 1/16

    IP-10/CRG-2/CXCL10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Mol Life Sci. 2024 Jul 13;81(1):300. [Abstract]

    Customer Validation
     (a) Representative images of the remaining extracellular and intracellular S. aureus colonies inoculated in TSA plates, and quantitative analysis of extracellular (b) and intracellular (c) bacterial colonies of neutrophils culture. After neutrophils were pre-stimulated with 100 ng/mL of recombinant CXCL9 (r-CXCL9, IP-10/CRG-2/CXCL10 Protein, Mouse, HY-P7227), recombinant CXCL10 (r-CXCL10), or a combination of them for 4 h, cells were challenged with S. aureus at MOI of 10 for 30 min. n = 3/ group.

  • 1/16

    IP-10/CRG-2/CXCL10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Mol Life Sci. 2024 Jul 13;81(1):300. [Abstract]

    Customer Validation
     Representative images of H&E staining and quantification of necrotic area per area of FOV. 10-month-old mice were injected with 1 µl r-CXCL10 (IP-10/CRG-2/CXCL10 Protein, Mouse, HY-P7227) (100 ng/µL) into the bone marrow where the implant was placed and S. aureus was injected, and right femurs were collected by day 3 after surgery for further analysis. n = 3/group. Scale bar = 50 μm.

  • IP-10/CRG-2/CXCL10 Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • Experimental Validation Results for IP-10/CRG-2/CXCL10 Protein, Mouse
  • IP-10/CRG-2/CXCL10 Protein, Mouse Product Image

  • IP-10/CRG-2/CXCL10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Mol Life Sci. 2024 Jul 13;81(1):300. [Abstract]

    (a) Representative images of the remaining extracellular and intracellular S. aureus colonies inoculated in TSA plates, and quantitative analysis of extracellular (b) and intracellular (c) bacterial colonies of neutrophils culture. After neutrophils were pre-stimulated with 100 ng/mL of recombinant CXCL9 (r-CXCL9, IP-10/CRG-2/CXCL10 Protein, Mouse, HY-P7227), recombinant CXCL10 (r-CXCL10), or a combination of them for 4 h, cells were challenged with S. aureus at MOI of 10 for 30 min. n = 3/ group.

  • IP-10/CRG-2/CXCL10 Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cell Mol Life Sci. 2024 Jul 13;81(1):300. [Abstract]

    Representative images of H&E staining and quantification of necrotic area per area of FOV. 10-month-old mice were injected with 1 µl r-CXCL10 (IP-10/CRG-2/CXCL10 Protein, Mouse, HY-P7227) (100 ng/µL) into the bone marrow where the implant was placed and S. aureus was injected, and right femurs were collected by day 3 after surgery for further analysis. n = 3/group. Scale bar = 50 μm.