1. Recombinant Proteins
  2. MIP-3 beta/CCL19 Protein, Mouse

MIP-3 beta/CCL19 Protein, Mouse

Cat. No.: HY-P7264
Handling Instructions

MIP-3 beta/CCL19 Protein, Mouse is a chemokine that binds to CCR7, modulates the inflammatory response.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $190 Ask For Quote & Lead Time
50 μg $420 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuMIP-3β/CCL19; C-C motif chemokine 19; SCYA19
Species

Mouse

Source

E. coli

Accession

O70460 (G26-S108)

Gene ID

24047

Molecular Weight

Approximately 9.2 kDa

AA Sequence

GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human mature dendritic cells is in a concentration range of 10-100 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Macrophage Inflammatory Protein-3 beta/CCL19 is a chemokine that binds to CCR7, modulates the inflammatory response. CCL19 and CXCL12 overexpressed in various tumors, which activate tumor proliferation related signaling pathway and stimulate angiogenesis on one hand, recruit immune cells infiltrating into cancerous foci and trigger tumor associated inflammation on the other. CCR7, one of G protein-coupled chemokine receptors, leads to alteration of cell skeleton rearrangement and cell migration by binding its ligand CCL19[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 beta/CCL19 Protein, Mouse
Cat. No.:
HY-P7264
Quantity:
MCE Japan Authorized Agent: