MIP-3 beta/CCL19 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The MIP-3 beta/CCL19 protein exhibits multifaceted effects affecting lymphocyte recycling, homing, and immune responses. It is involved in T cell trafficking in the thymus and guides T cells and B cells to secondary lymphoid organs by binding to CCR7. MIP-3 beta/CCL19 Protein, Human is the recombinant human-derived MIP-3 beta/CCL19 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MIP-3 beta/CCL19 protein exhibits multifaceted effects affecting lymphocyte recycling, homing, and immune responses. It is involved in T cell trafficking in the thymus and guides T cells and B cells to secondary lymphoid organs by binding to CCR7. MIP-3 beta/CCL19 Protein, Human is the recombinant human-derived MIP-3 beta/CCL19 protein, expressed by E. coli , with tag free.

Background

MIP-3 beta/CCL19 Protein is suggested to have a multifaceted role, extending beyond inflammatory and immunological responses to encompass normal lymphocyte recirculation and homing. Its potential involvement in the trafficking of T-cells in the thymus, as well as the migration of both T-cells and B-cells to secondary lymphoid organs, underscores its importance in orchestrating cellular movements crucial for immune surveillance and responses. Acting through its binding to the chemokine receptor CCR7, MIP-3 beta/CCL19 demonstrates potent chemotactic activity specifically for T-cells and B-cells, excluding granulocytes and monocytes from its recruitment. Furthermore, it binds to the atypical chemokine receptor ACKR4, facilitating the recruitment of beta-arrestin (ARRB1/2) to ACKR4. Notably, MIP-3 beta/CCL19 interacts with TNFAIP6 via its Link domain, adding another layer to its complex network of molecular associations. The diverse functions of MIP-3 beta/CCL19 highlight its pivotal role in immune cell dynamics and underscore the need for comprehensive exploration into its regulatory mechanisms.

Verified Bioactivity

Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 10-40 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is 27.79 ng/mL, corresponding to a specific activity is 3.598×104 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL19 (G22-S98)
      Accession # Q99731
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL19; Small-Inducible Cytokine A19; Prev. SCYA19; CC Chemokine Ligand 19; ELC; C-C Motif Chemokine 19; CK Beta-11; EBI1-Ligand Chemokine; Exodus-3; MIP-3-Beta; MIP-3b; MIP3B; CKb11; Macrophage Inflammatory Protein 3 Beta; Small Inducible Cytokine Subfami

  • AA Sequence

    GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

  • Predicted Molecular Mass

    8.8 kDa

  • Molecular Weight

    Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00