SDF-1 beta/CXCL12 Protein, Mouse

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93).

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Mouse is produced in E. coli, and consists of 72 amino acids (K22-M93).

Background

The chemokine stromal-derived factor-1 (SDF-1), which is constitutively expressed in most tissues as SDF-1α and SDF-1β resulting from alternative gene splicing, regulates hematopoiesis, lymphocyte homing, B-lineage cell growth, and angiogenesis[1][2]. SDF-1β is assigned to the intercrine cytokine family (chemokines) which is characterized by four conserved cysteines that form two disulfide bonds. Furthermore its expression is found in all organs except in blood cells[3].
SDF-1β which is virtually the same as SDF-1α, except in that the fourth exon consists of only four residues attached to a C-terminus, shows very similar activity in vitro and in tissues, but is twice as potent in the blood. SDF-1α comprises 3 exons and encodes a protein of 89 amino acids whereas SDF-1β consists of 4 exons and encodes a protein of 93 amino acids. Both isoforms are highly similar regarding their sequences with the only difference of 4 additional amino acids at the C-terminus of SDF1β[1][2]. In addition, SDF-1β is shown to be a sufficient factor capable of supporting rodent B-cell lymphopoiesis. SDF-1β is expressed less abundantly and seems to be related to the vascular system. Its greater resistance to proteolysis within the blood predispose it to this role[3].
Endothelial cells of cerebral microvessels in mice express SDF-1β selectively. Its upregulation is found following focal cerebral ischemia and is associated with the infiltration of CXCR4-expressing peripheral blood cells, such as macrophages. SDF-1β also has a greater effect on angiogenesis in human microvascular endothelial cells (HMEC)[3]. Compared with SDF-1α, SDF-1β is more resistant to blood-dependent degradation, stimulates angiogenesis and is present in highly vascularized organs such as: the liver, spleen and kidneys[4].

In Vivo

Recombinant mouse SDF-1β (5 mg/kg; tail vein; twice a week; for 3 months) injected into mice bearing type 2 diabetes (T2D). SDF-1β prevents T2D-induced cardiac dysfunction and fibrosis and T2D-down-regulated KLF15 expression in wild-type diabetic heart tissue[5].

Verified Bioactivity

1. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 50-100 ng/mL.
2. Measured by its ability to inhibit proliferation of Jurkat cells. The ED50 this effect is 2.589 ng/mL, corresponding to a specific activity is 3.86×10^5 units/mg.
3. Measured by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is 0.8552 ng/mL, corresponding to a specific activity is 1.169×10^6 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL12 (K22-M93)
      Accession # P40224-2
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    CXCL12; Intercrine Reduced In Hepatomas; Prev. SDF1; SDF-1b; Prev. SDF1A; TLSF-A; Prev. SDF1B; TLSF-B; PBSF; IRH; Stromal Cell-Derived Factor 1; C-X-C Motif Chemokine 12; SCYB12; HSDF-1; TPAR1; SDF-1; Pre-B Cell Growth-Stimulating Factor; TLSF; Chemokine

  • AA Sequence

    KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

  • Predicted Molecular Mass

    8.5 kDa

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00