SDF-1 alpha/CXCL12 Protein, Mouse
Based on 2 publication(s) in Google Scholar
SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow. SDF-1 alpha/CXCL12 Protein, Mouse is produced in E. coli.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow[1][2]. SDF-1 alpha/CXCL12 Protein, Mouse is produced in E. coli.
Stromal cell-derived factor-1 (SDF-1), an important member of the chemokine family, is expressed in two subtypes, SDF-1α and SDF-1β, with SDF-1α being the main subtype. SDF-1α is widely present in many tissues and organs of the human body, such as the lymph nodes, bone marrow, liver, lung, muscle, small intestine, kidney, and brain, and can sustainably exist in these organs and tissues. Studies have shown that SDF-1α plays an important role in the physiological mfunctions of migration, distribution, development, differentiation, and apoptosis of various cells. Moreover, SDF-1α plays a key role in the pathological process of some diseases, such as inflammation, tumor formation and metastasis, pathogen infection, and wound repair[1][3].
SDF-1 has three isoforms, α, β, and γ, which are different at the splicing level, not at the transcriptional level. The analysis of the genomic structure of SDF-1 in human and mouse revealed two isoforms, SDF-1α and SDF-1β, which are encoded by a single gene and result from alternative splicing. SDF-1α comprises 3 exons and encodes a protein of 89 amino acids whereas SDF-1β consists of 4 exons and encodes a protein of 93 amino acids. Both isoforms are highly similar regarding their sequences with the only difference of 4 additional amino acids at the C-terminus of SDF1β. In adult rat brain, SDF-1α is the predominant one, present in astrocytes, microglia, as well as in neurons. SDF-1α is found positive in normal cholinergic neurons, such as in the medial septum and substantia innominata, and in dopaminergic neurons, such as in the substantia nigra (SN) pars compacta and the ventral tegmental area. SDF-1α is the only known ligand for CXCR4. CXCR4 is also a target for human immunodeficiency virus (HIV) binding[1][2].
In vitro and in vivo studies using ischemic reperfusion models and a pretreatment with SDF-1α results in decreased infarct size and increases resistance to hypoxic damage and apoptotic cell death via activation of ERK-1/2 and AKT phosphorylation[1]. The SDF-1α/CXCR4 signaling maintains central nervous system homeostasis through the interaction with the neurotransmitter and neuropeptide systems, the neuroendocrine systems[2]. An increasing number of animal experiments have shown that SDF-1α can enhance the migration of BMSCs, mobilize BMSCs to diseased areas, and promote their proliferation and differentiation[3].
Recombinant mouse SDF-1α (10 ng/mL or 30 ng/mL; for 6 days) promotes osteoclast differentiation and activity in bone marrow mononuclear cells (BMMCs). SDF-1α can promote osteoclast formation and the expression oftartrate resistant acid phosphatase (TRAP), cathepsin K (CK), and MMP-9 in osteoclasts by activating the MAPK pathway, including ERK and p38, but not JNK[4].
In a mouse acute myocardial infarction (AMI) model, recombinant mouse SDF-1α (100 ng/50 μL) injected into the infarctregions of the myocardium 3 to 4 times per mouse. Two weeks after infarction, the myocardial recruitment of c-kit+ cells is significantly higher in the group treated with the SDF-1alpha PEGylated fibrin patch than in the AMI control group[5].
1.Full biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 50-100 ng/mL.
2.Measured by its ability to chemoattract IL-2-activated human T cells. The ED50 for this effect is approximately 20-50 ng/mL.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Int Immunopharmacol
Isoferulic acid regulates CXCL12/CXCR4-mediated apoptosis and autophagy in podocyte and mice with STZ-induced diabetic nephropathy. [Abstract]2025 Jan 10:144:113707. PMID: 39616856 -
J Neurosci Res
Bone Marrow Mesenchymal Stem Cells Improve Cognitive Impairment Induced by Neuropathic Pain Through Blood CXCL12/CXCR4 Axis in Male Mice. [Abstract]2026 Feb;104(2):e70111. PMID: 41603234
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P40224-1 (K22-K89)
-
Molecular Construction
-
N-term
-
SDF-1 alpha/CXCL12 (K22-K89)
Accession # P40224-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
CXCL12; Intercrine Reduced In Hepatomas; Prev. SDF1; SDF-1b; Prev. SDF1A; TLSF-A; Prev. SDF1B; TLSF-B; PBSF; IRH; Stromal Cell-Derived Factor 1; C-X-C Motif Chemokine 12; SCYB12; HSDF-1; TPAR1; SDF-1; Pre-B Cell Growth-Stimulating Factor; TLSF; Chemokine
-
AA Sequence
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
-
Predicted Molecular Mass
8 kDa
-
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Santhosh K Ghadge, et al. SDF-1α as a therapeutic stem cell homing factor in myocardial infarction. Pharmacol Ther. 2011 Jan;129(1):97-108. [Content Brief]
[2]. Kryczek I, et al. Stroma-derived factor (SDF-1/CXCL12) and human tumor pathogenesis. Am J Physiol Cell Physiol. 2007 Mar;292(3):C987-95. [Content Brief]
[3]. Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21(3-4):240-58. [Content Brief]
[4]. Zhiqiang Meng, et al. SDF Factor-1α Promotes the Migration, Proliferation, and Osteogenic Differentiation of Mouse Bone Marrow Mesenchymal Stem Cells Through the Wnt/β-Catenin Pathway. Stem Cells Dev. 2021 Jan 15;30(2):106-117. [Content Brief]
[5]. Yonghui Dong, et al. Inhibition of SDF-1α/CXCR4 Signalling in Subchondral Bone Attenuates Post-Traumatic Osteoarthritis. Int J Mol Sci. 2016 Jun 16;17(6):943. [Content Brief]
[6]. Ge Zhang, et al. Controlled release of stromal cell-derived factor-1 alpha in situ increases c-kit+ cell homing to the infarcted heart. Tissue Eng. 2007 Aug;13(8):2063-71. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)