MIP-2/CXCL2 Protein, Mouse

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. MIP-2/CXCL2 Protein, Mouse is produced in E. coli, and consists of 74 amino acids (A27-N100).

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. MIP-2/CXCL2 Protein, Mouse is produced in E. coli, and consists of 74 amino acids (A27-N100).

Background

CXCL2 is a chemokine induced by endotoxin and serves as an extremely potent chemo-attractant for neutrophils, acting as a crucial inflammatory mediator. CXCL2 could be produced by multiple, different cell types, including macrophages and cancer cells. CXCL2 is involved in cancer metastasis, angiogenesis, and wound healing[1][4][5].
The amino acid sequence of human CXCL2 protein has low homology between mouse and rat CXCL2 protein.
CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 binds to the G-protein coupled receptor CXCR2 (IL-8RB) expressed on macrophages, neutrophils, and epithelial cells and its classical function is to act as chemotactic factors attracting neutrophils to sites of injury[2][3].
In enterocytes, LPS induces CXCL2 expression and promotes migration of neutrophils in a model of platelet-activating factor induced shock and bowel injury. In acute lung injury, CXCR2 ligands, including CXCL1/2/3, have chemotactic effects for polymorphonuclear leukocytes[4]. CXCL2 could provoke a dose-dependent increase of colorectal tumor cell migration in vitro. Further, according to Bachmeier et al., CXCL-1 and −2 silencing could down-regulate several metastasis-promoting genes and inhibit the metastatic potential of breast cancer cells[5].

Verified Bioactivity

1. The ED50 is <1 ng/mL as measured by CHO-K1/Gα15/mCXCR2 cells (human Gα15 and mouse CXCR2 stably expressed in CHO-K1 cells).
2. Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 24.09 ng/ml, corresponding to a specific activity is 41511 units/mg.
3. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR2. The ED50 for this effect is 1.0-10.0 ng/mL, corresponding to a specific activity is ≤2.130×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 24.09 ng/mL, corresponding to a specific activity is 41511 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL2 (G27-N100)
      Accession # P10889
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CXCL2; Growth-Regulated Protein Beta; Prev. GRO2; GRO2 Oncogene; SCYB2; MIP2-Alpha; CINC-2a; Gro-Beta; MGSA-B; MIP2A; MIP-2a; Melanoma Growth Stimulatory Activity Beta; GROb; MGSA Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2; Chemokine (C-X-C Motif

  • AA Sequence

    GAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN

  • Predicted Molecular Mass

    7.9 kDa

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00