GRO-beta/CXCL2 Protein, Human
Based on 2 publication(s) in Google Scholar
CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis. GRO-beta/CXCL2 Protein, Human is produced in E. coli, and consists of 73 amino acids (A35-N107).
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CXCL2, also called Gro-beta or MIP-2, is a pro-inflammatory cytokine with chemotactic activities on neutrophils. CXCL2 is produced by activated monocytes and neutrophils and expressed at sites of inflammation. CXCL2 is involved in many immune responses including wound healing, cancer metastasis, and angiogenesis[1][2]. GRO-beta/CXCL2 Protein, Human is produced in E. coli, and consists of 73 amino acids (A35-N107).
Background
CXCL2 is a chemokine induced by endotoxin and serves as an extremely potent chemo-attractant for neutrophils, acting as a crucial inflammatory mediator. CXCL2 could be produced by multiple, different cell types, including macrophages and cancer cells. CXCL2 is involved in cancer metastasis, angiogenesis, and wound healing[1][4][5].
The amino acid sequence of human CXCL2 protein has low homology between mouse and rat CXCL2 protein.
CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 binds to the G-protein coupled receptor CXCR2 (IL-8RB) expressed on macrophages, neutrophils, and epithelial cells and its classical function is to act as chemotactic factors attracting neutrophils to sites of injury[2][3].
In enterocytes, LPS induces CXCL2 expression and promotes migration of neutrophils in a model of platelet-activating factor induced shock and bowel injury. In acute lung injury, CXCR2 ligands, including CXCL1/2/3, have chemotactic effects for polymorphonuclear leukocytes[4]. CXCL2 could provoke a dose-dependent increase of colorectal tumor cell migration in vitro. Further, according to Bachmeier et al., CXCL-1 and −2 silencing could down-regulate several metastasis-promoting genes and inhibit the metastatic potential of breast cancer cells[5].
Verified Bioactivity
The ED50 is <200 ng/mL as measured by GRO-beta, Human on Ca2+ mobilization assay in CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells).
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cancer Cell Int
Schisandrin B exerts anti-colorectal cancer effect through CXCL2/ERK/DUSP11 signaling pathway. [Abstract]2025 Mar 15;25(1):97. PMID: 40089741 -
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P19875 (A35-N107)
-
Molecular Construction
-
N-term
-
CXCL2 (A35-N107)
Accession # P19875 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL2; Growth-Regulated Protein Beta; Prev. GRO2; GRO2 Oncogene; SCYB2; MIP2-Alpha; CINC-2a; Gro-Beta; MGSA-B; MIP2A; MIP-2a; Melanoma Growth Stimulatory Activity Beta; GROb; MGSA Beta; Macrophage Inflammatory Protein 2-Alpha; MIP2; Chemokine (C-X-C Motif
-
AA Sequence
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Laila A Al-Alwan, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191(5):2731-41. [Content Brief]
[2]. Pelus LM, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34(8):1010-20. [Content Brief]
[3]. Louis M Pelus, et al. Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties. Exp Hematol. 2006 Aug;34(8):1010-20. [Content Brief]
[4]. Al-Alwan LA, et al. Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration. J Immunol. 2013 Sep 1;191(5):2731-41. [Content Brief]
[5]. Aimalie L Hardaway, et al. Marrow adipocyte-derived CXCL1 and CXCL2 contribute to osteolysis in metastatic prostate cancer. Clin Exp Metastasis. 2015 Apr;32(4):353-68. [Content Brief]
[6]. Jeongim Ha, et al. CXCL2 mediates lipopolysaccharide-induced osteoclastogenesis in RANKL-primed precursors. Cytokine. 2011 Jul;55(1):48-55. [Content Brief]
[7]. Yu Lu, et al. Type conversion of secretomes in a 3D TAM2 and HCC cell co-culture system and functional importance of CXCL2 in HCC. Sci Rep. 2016 Apr 27;6:24558. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)