IL-17A Protein, Mouse (HEK293, His)

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases^[1][2]. IL-17A Protein, Mouse (HEK293, His) is a recombinant mouse IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 137 amino acids (T22-A158).

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4⁺ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8⁺ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils^[1][2][3].
The mouse IL-17A shares 63.23% amino acid sequence identity with human and 87.33% identity with rat.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6^[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer^[1][4].

Recombinant mouse interleukin 17 (rmIL-17) (0.1 or 0.9 μg/rat/day; nasally; 6 days) shows increased infiltration of inflammatory cells into the sciatic nerve, more severe demyelination, augmented proliferation of regional lymph node cells, and increased serum levels of tumor necrosis factor-α in chronic experimental autoimmune neuritis (EAN) induced Lewis rats^[5].
rmIL-17A (625 ng/mouse; i.t.; once) dramatically synergizes TNF-alpha induced neutrophil accumulation in C57BL/6 mice^[6].

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.25-2.495 ng/mL, corresponding to a specific activity is 4.01×10⁵ - 4×10⁶ U/mg.

• 
  Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 2.495 ng/mL, corresponding to a specific activity is 4.01×10⁵ U/mg.

Mouse

HEK293

C-6*His

Q62386 (T22-A158)

16171  [NCBI]

Full Length of Mature Protein

TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

Approximately 17-26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14.  [Content Brief]

  [2]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79.  [Content Brief]

  [3]. Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10(7):479-89.  [Content Brief]

  [4]. Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181(4):2799-805.  [Content Brief]

  [5]. Pelidou SH, et al. Enhancement of acute phase and inhibition of chronic phase of experimental autoimmune neuritis in Lewis rats by intranasal administration of recombinant mouse interleukin 17: potential immunoregulatory role. Exp Neurol. 2000 May;163(1):165-72.  [Content Brief]

  [6]. Liu Y, et al. IL-17A and TNF-α exert synergistic effects on expression of CXCL5 by alveolar type II cells in vivo and in vitro. J Immunol. 2011 Mar 1;186(5):3197-205.  [Content Brief]