Copy Link Print Information

IL-17A Protein, Mouse (HEK293, His)

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Mouse (HEK293, His) is a recombinant mouse IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 137 amino acids (T22-A158).

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • IL-17A Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Mouse (HEK293, His) is a recombinant mouse IL-17A protein with His tag at the C-terminus and is expressed in HEK293 cells. It consists of 137 amino acids (T22-A158).

Background

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The mouse IL-17A shares 63.23% amino acid sequence identity with human and 87.33% identity with rat.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

In Vivo

Recombinant mouse interleukin 17 (rmIL-17) (0.1 or 0.9 μg/rat/day; nasally; 6 days) shows increased infiltration of inflammatory cells into the sciatic nerve, more severe demyelination, augmented proliferation of regional lymph node cells, and increased serum levels of tumor necrosis factor-α in chronic experimental autoimmune neuritis (EAN) induced Lewis rats[5].
rmIL-17A (625 ng/mouse; i.t.; once) dramatically synergizes TNF-alpha induced neutrophil accumulation in C57BL/6 mice[6].

Verified Bioactivity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.25-2.495 ng/mL, corresponding to a specific activity is 4.01×105 - 4×106 U/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q62386 (T22-A158)

  • Gene ID
    16171  [NCBI]
  • Molecular Construction
    • N-term
    • IL-17A (T22-A158)
      Accession # Q62386
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL17A; Cytotoxic T-Lymphocyte-Associated Protein 8; Prev. CTLA8; Interleukin-17A; Prev. IL17; CTLA-8; IL-17A; Interleukin-17; IL-17; ILA17; Interleukin 17 (Cytotoxic T-Lymphocyte-Associated Serine Esterase 8); Interleukin 17A; Cytotoxic T-Lymphocyte-Assoc

  • AA Sequence

    TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

  • Predicted Molecular Mass

    16.2 kDa

  • Molecular Weight

    Approximately 17-26 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Chen K, et al. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14. [Content Brief]

[2]. Iwakura Y, et al. The roles of IL-17A in inflammatory immune responses and host defense against pathogens. Immunol Rev. 2008 Dec;226:57-79. [Content Brief]

[3]. Cua DJ, et al. Innate IL-17-producing cells: the sentinels of the immune system. Nat Rev Immunol. 2010 Jul;10(7):479-89. [Content Brief]

[4]. Wright JF, et al. The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-17RA/IL-17RC receptor complex. J Immunol. 2008 Aug 15;181(4):2799-805. [Content Brief]

[5]. Pelidou SH, et al. Enhancement of acute phase and inhibition of chronic phase of experimental autoimmune neuritis in Lewis rats by intranasal administration of recombinant mouse interleukin 17: potential immunoregulatory role. Exp Neurol. 2000 May;163(1):165-72. [Content Brief]

[6]. Liu Y, et al. IL-17A and TNF-α exert synergistic effects on expression of CXCL5 by alveolar type II cells in vivo and in vitro. J Immunol. 2011 Mar 1;186(5):3197-205. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2.495 ng/mL, corresponding to a specific activity is 4.01×105 U/mg.

  • 1/16

    IL-17A Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Brain Behav Immun. 2026 Feb:132:106218. [Abstract]

    Customer Validation
     IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) markedly exacerbated chronic pruritus in IMQ-treated mice.

  • 1/16

    IL-17A Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Brain Behav Immun. 2026 Feb:132:106218. [Abstract]

    Customer Validation
     IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) intensified IMQ-induced pathological alterations in C57BL/6J mice.

  • 1/16

    IL-17A Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Brain Behav Immun. 2026 Feb:132:106218. [Abstract]

    Customer Validation
     IL-17A Protein, Mouse (HEK293, His) (100 ng/mL; 12 h) markedly enhanced IL-6 mRNA levels and extracellular IL-6 protein secretion in the DRG neurons.

  • 1/16

    IL-17A Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Brain Behav Immun. 2026 Feb:132:106218. [Abstract]

    Customer Validation
     The IL-6 expression in DRG neurons of IMQ-induced psoriatic mice injected with IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) was detected by immunofluorescent staining.

  • 1/16

    IL-17A Protein, Mouse (HEK293, His) purchased from MedChemExpress. Usage Cited in: Brain Behav Immun. 2026 Feb:132:106218. [Abstract]

    Customer Validation
     IL-17A Protein, Mouse (HEK293, His) (100 ng; i.c.) promoted the mRNA level of IL-6 in DRG tissues of IMQ-induced psoriasis model mice.

  • IL-17A Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • Experimental Validation Results for IL-17A Protein, Mouse (HEK293, His)
  • IL-17A Protein, Mouse (HEK293, His) Product Image