Copy Link Print Information

SDF-1 alpha/CXCL12 Protein, Human

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

SDF-1 alpha (CXCL12α) belongs to the CXC chemokine family and is encoded by the CXCL12 gene. SDF-1 alpha mediates cell chemotaxis and tissue repair through CXCR4/CXCR7, activates AMPK to inhibit NLRP3 inflammasome and pyroptosis; SDF-1 alpha promotes autophagy through the PI3K-mTOR pathway, is induced by upstream inflammatory factors such as TNF-α, and recruits integrins downstream to promote cell adhesion. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • SDF-1 alpha/CXCL12 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SDF-1 alpha (CXCL12α) belongs to the CXC chemokine family and is encoded by the CXCL12 gene. SDF-1 alpha mediates cell chemotaxis and tissue repair through CXCR4/CXCR7, activates AMPK to inhibit NLRP3 inflammasome and pyroptosis; SDF-1 alpha promotes autophagy through the PI3K-mTOR pathway, is induced by upstream inflammatory factors such as TNF-α, and recruits integrins downstream to promote cell adhesion[1]. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli, with tag free.

Background

SDF-1 alpha (stromal cell-derived factor 1 alpha, CXCL12α) is a member of the CXC chemokine family. It is encoded by the CXCL12 gene and contains four conserved cysteines that form two disulfide bonds (Cys9-Cys34, Cys11-Cys50). It lacks an ELR (Glu-Leu-Arg) domain. The mature peptide of SDF-1 alpha generally contains 68 amino acids and has a molecular weight of approximately 8 kDa. It is the main active isomer of SDF-1 (the other isomer is SDF-1β)[1].
SDF-1 alpha mediates cell chemotaxis (such as hematopoietic stem cells, T cells, and monocytes) through the receptor CXCR4, regulating tissue repair, angiogenesis, and inflammatory responses. SDF-1 alpha is involved in the AMPK pathway: In osteoarthritis (OA) synovial fibroblasts, SDF-1α activates AMPK and inhibits NLRP3 inflammasome (NLRP3/ASC/caspase-1) and pyroptosis (GSDMD/IL-1β). SDF-1 alpha is also involved in the PI3K-mTOR pathway: PI3K-mTOR is activated through CXCR4 to promote autophagy (such as increased LC3II and decreased p62 in chondrocytes), but this pathway does not directly mediate inflammation inhibition. SDF-1 alpha is first induced by upstream inflammatory factors (such as TNF-α and IL-1β), and recruits integrins (such as VLA-4) through downstream CXCR4 to promote cell adhesion and migration[1].
SDF-1 alpha can be used to study diseases or mechanisms such as osteoarthritis (OA), inflammation, and autophagy. For example, intra-articular injection of SDF-1 alpha can alleviate collagenase-induced OA in mice, inhibit synovial inflammation and cartilage degradation; SDF-1 alpha promotes autophagy in chondrocytes through the CXCR4/mTOR axis, protecting cells from stress damage[1]. In stem cell biology, SDF-1 alpha also regulates hematopoietic stem cell homing (such as enhancing CXCR4 expression in bone marrow transplantation)[2].

Verified Bioactivity

1. Full biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/mL.
2. Measured by its ability to chemoattract IL-2-activated human T cells. The ED50 for this effect is approximately ≤45.17 ng/mL, corresponding to a specific activity is ≥2.214×104 U/mg.
3. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR4. The ED50 for this effect is 0.3-1.0 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P48061-2 (K22-K89)

  • Gene ID
    6387  [NCBI]
  • Molecular Construction
    • N-term
    • CXCL12 (K22-K89)
      Accession # P48061-2
    • C-term
  • Protein Length

    Full Length of Isoform-2 Mature Protein

  • Synonyms

    CXCL12; Intercrine Reduced In Hepatomas; Prev. SDF1; SDF-1b; Prev. SDF1A; TLSF-A; Prev. SDF1B; TLSF-B; PBSF; IRH; Stromal Cell-Derived Factor 1; C-X-C Motif Chemokine 12; SCYB12; HSDF-1; TPAR1; SDF-1; Pre-B Cell Growth-Stimulating Factor; TLSF; Chemokine

  • AA Sequence

    KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

  • Predicted Molecular Mass

    8 kDa

  • Molecular Weight

    Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 130 mM NaCl, pH 7.3.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Wang S, et al. Exogenous stromal cell-derived factor-1 (SDF-1) suppresses the NLRP3 inflammasome and inhibits pyroptosis in synoviocytes from osteoarthritic joints via activation of the AMPK signaling pathway. Inflammopharmacology. 2021 Jun;29(3):695-704. [Content Brief]

[2]. Hayakawa J, et al. Dextran sulfate and stromal cell derived factor-1 promote CXCR4 expression and improve bone marrow homing efficiency of infused hematopoietic stem cells. J Nippon Med Sch. 2009 Aug;76(4):198-208. [Content Brief]

[3]. Warner JA, et al. Human cytomegalovirus infection inhibits CXCL12- mediated migration and invasion of human extravillous cytotrophoblasts. Virol J. 2012 Nov 1;9:255. [Content Brief]

[4]. Yadav SS, et al. CXCL12 is a key regulator in tumor microenvironment of cervical cancer: an in vitro study. Clin Exp Metastasis. 2016 Jun;33(5):431-9. [Content Brief]

[5]. Hoh BL, et al. Stromal cell-derived factor-1 promoted angiogenesis and inflammatory cell infiltration in aneurysm walls. J Neurosurg. 2014 Jan;120(1):73-86. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract BaF3 mouse pro B cells transfected with human CXCR4. The ED50 for this effect is 0.3559 ng/mL, corresponding to a specific activity is 2.810×106 U/mg.

  • 1/16

    SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Customer Validation
     Andrographolide (30 μM, 48 h) reversed SDF-1 (100 ng/mL, 48 h)-induced cell growth inhibition in chondrocytes.

  • 1/16

    SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Customer Validation
     Andrographolide (30 μM, 48 h) reversed the SDF-1 (100 ng/mL, 48 h)-induced decrease in COL2A1 and ACAN content in chondrocytes.

  • 1/16

    SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Customer Validation
     Andrographolide (30 μM, 48 h) reversed SDF-1 (100 ng/mL, 48 h)-induced expression of TNF-α, IL-6, and IL-1β in chondrocytes.

  • 1/16

    SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Customer Validation
     Andrographolide (30 μM, 48 h) reversed SDF-1 (100 ng/mL, 48 h)-induced expression of STAT3, TP53, JUN, HIF-1α, TGF-β1, and AKT1.

  • SDF-1 alpha/CXCL12 Protein, Human Product Image
    1/16
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • Experimental Validation Results for SDF-1 alpha/CXCL12 Protein, Human
  • SDF-1 alpha/CXCL12 Protein, Human Product Image

  • SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Andrographolide (30 μM, 48 h) reversed SDF-1 (100 ng/mL, 48 h)-induced cell growth inhibition in chondrocytes.

  • SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Andrographolide (30 μM, 48 h) reversed the SDF-1 (100 ng/mL, 48 h)-induced decrease in COL2A1 and ACAN content in chondrocytes.

  • SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Andrographolide (30 μM, 48 h) reversed SDF-1 (100 ng/mL, 48 h)-induced expression of TNF-α, IL-6, and IL-1β in chondrocytes.

  • SDF-1 alpha/CXCL12 Protein, Human purchased from MedChemExpress. Usage Cited in: Gene. 2024 Jun 15:911:148351. [Abstract]

    Andrographolide (30 μM, 48 h) reversed SDF-1 (100 ng/mL, 48 h)-induced expression of STAT3, TP53, JUN, HIF-1α, TGF-β1, and AKT1.